Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RXZ2

Protein Details
Accession A0A1X0RXZ2   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
180-205DLNQKIRVCVRKRPLNKKEIERGEKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027640  Kinesin-like_fam  
IPR001752  Kinesin_motor_dom  
IPR001660  SAM  
IPR013761  SAM/pointed_sf  
Gene Ontology GO:0005856  C:cytoskeleton  
GO:0005524  F:ATP binding  
GO:0008017  F:microtubule binding  
GO:0003777  F:microtubule motor activity  
GO:0007018  P:microtubule-based movement  
Pfam View protein in Pfam  
PF00536  SAM_1  
PROSITE View protein in PROSITE  
PS50067  KINESIN_MOTOR_2  
PS50105  SAM_DOMAIN  
Amino Acid Sequences MSMLLLETLKKAELDQYYSSFSANGITQLESLAQLSLQEYSSLGITSVADRKKLFHLVQSLRQETPSLENGLVSSSLKPLSYKHRSPSTNNVDTVRRGSAAQIIQSPIPTRTRSRTLPSFEKPDFISDRGEEAVEESDEDEEKCEIRRGSNPLLDPYGVPIKSRYQQKSSPLVVSSQPSDLNQKIRVCVRKRPLNKKEIERGEKDIAPTCGMRSINVHEPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.3
5 0.3
6 0.3
7 0.23
8 0.2
9 0.18
10 0.15
11 0.14
12 0.11
13 0.12
14 0.12
15 0.12
16 0.12
17 0.1
18 0.1
19 0.08
20 0.07
21 0.06
22 0.07
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.09
34 0.15
35 0.16
36 0.18
37 0.19
38 0.21
39 0.24
40 0.31
41 0.29
42 0.28
43 0.36
44 0.38
45 0.46
46 0.51
47 0.5
48 0.43
49 0.43
50 0.39
51 0.31
52 0.3
53 0.24
54 0.19
55 0.16
56 0.15
57 0.15
58 0.15
59 0.14
60 0.11
61 0.09
62 0.08
63 0.08
64 0.09
65 0.09
66 0.11
67 0.2
68 0.27
69 0.31
70 0.35
71 0.43
72 0.46
73 0.51
74 0.58
75 0.58
76 0.55
77 0.52
78 0.49
79 0.43
80 0.4
81 0.38
82 0.28
83 0.2
84 0.15
85 0.14
86 0.16
87 0.15
88 0.14
89 0.14
90 0.14
91 0.13
92 0.14
93 0.14
94 0.11
95 0.13
96 0.14
97 0.16
98 0.19
99 0.24
100 0.26
101 0.31
102 0.35
103 0.38
104 0.43
105 0.44
106 0.46
107 0.42
108 0.41
109 0.36
110 0.34
111 0.3
112 0.25
113 0.23
114 0.17
115 0.18
116 0.16
117 0.16
118 0.11
119 0.1
120 0.1
121 0.08
122 0.07
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.06
129 0.07
130 0.08
131 0.12
132 0.12
133 0.13
134 0.19
135 0.24
136 0.28
137 0.32
138 0.32
139 0.31
140 0.32
141 0.31
142 0.25
143 0.23
144 0.24
145 0.2
146 0.19
147 0.19
148 0.22
149 0.28
150 0.37
151 0.39
152 0.39
153 0.44
154 0.51
155 0.57
156 0.55
157 0.52
158 0.44
159 0.41
160 0.38
161 0.35
162 0.3
163 0.24
164 0.22
165 0.2
166 0.25
167 0.26
168 0.28
169 0.31
170 0.31
171 0.34
172 0.4
173 0.48
174 0.47
175 0.54
176 0.59
177 0.64
178 0.72
179 0.79
180 0.81
181 0.81
182 0.85
183 0.85
184 0.85
185 0.85
186 0.83
187 0.77
188 0.74
189 0.7
190 0.64
191 0.57
192 0.52
193 0.44
194 0.38
195 0.34
196 0.29
197 0.29
198 0.27
199 0.25
200 0.23
201 0.28