Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RMY5

Protein Details
Accession A0A1X0RMY5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MIRVKGKNKKTKRKKKRKGKHLSKVNQKKGLVBasic
NLS Segment(s)
PositionSequence
4-35VKGKNKKTKRKKKRKGKHLSKVNQKKGLVKIK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010095  Transposase_IS605_OrfB_C  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0032196  P:transposition  
Pfam View protein in Pfam  
PF07282  OrfB_Zn_ribbon  
Amino Acid Sequences MIRVKGKNKKTKRKKKRKGKHLSKVNQKKGLVKIKTHRVGVTEVLYKQLKKRQKSGELLLAMMNEFCTSKVCHPCQDMTLTTTMIDLHSVLTCKSCGIIWQRDLNAFKNIFKISKDINTGYSRPPIFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.97
3 0.97
4 0.96
5 0.97
6 0.96
7 0.96
8 0.95
9 0.94
10 0.94
11 0.94
12 0.92
13 0.89
14 0.8
15 0.76
16 0.74
17 0.73
18 0.67
19 0.63
20 0.62
21 0.64
22 0.67
23 0.62
24 0.54
25 0.46
26 0.44
27 0.38
28 0.33
29 0.27
30 0.21
31 0.24
32 0.25
33 0.23
34 0.26
35 0.31
36 0.35
37 0.35
38 0.43
39 0.47
40 0.54
41 0.58
42 0.58
43 0.57
44 0.5
45 0.47
46 0.39
47 0.3
48 0.22
49 0.16
50 0.12
51 0.05
52 0.05
53 0.04
54 0.05
55 0.07
56 0.12
57 0.19
58 0.21
59 0.24
60 0.26
61 0.27
62 0.27
63 0.29
64 0.25
65 0.19
66 0.19
67 0.16
68 0.14
69 0.13
70 0.11
71 0.08
72 0.08
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.11
84 0.18
85 0.24
86 0.27
87 0.32
88 0.34
89 0.39
90 0.42
91 0.4
92 0.4
93 0.36
94 0.33
95 0.33
96 0.34
97 0.3
98 0.29
99 0.3
100 0.28
101 0.32
102 0.36
103 0.33
104 0.36
105 0.39
106 0.4
107 0.4
108 0.44