Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1NSW5

Protein Details
Accession A0A0A1NSW5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-37THTLCRRCGNRAFHKQKKTCAQCHydrophilic
NLS Segment(s)
PositionSequence
52-75KGKRRKTTGTGRMAHLKEVHRRFK
Subcellular Location(s) mito 12, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHTKTHTLCRRCGNRAFHKQKKTCAQCGYPSAKIRSFNWSEKGKRRKTTGTGRMAHLKEVHRRFKNGFREGSQAKKQTAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.7
4 0.67
5 0.71
6 0.74
7 0.73
8 0.7
9 0.72
10 0.7
11 0.7
12 0.74
13 0.79
14 0.78
15 0.81
16 0.79
17 0.8
18 0.81
19 0.77
20 0.73
21 0.68
22 0.62
23 0.56
24 0.59
25 0.55
26 0.5
27 0.48
28 0.43
29 0.4
30 0.39
31 0.36
32 0.36
33 0.35
34 0.33
35 0.35
36 0.39
37 0.42
38 0.49
39 0.58
40 0.59
41 0.59
42 0.61
43 0.61
44 0.63
45 0.68
46 0.68
47 0.67
48 0.62
49 0.61
50 0.64
51 0.58
52 0.53
53 0.47
54 0.43
55 0.43
56 0.49
57 0.55
58 0.51
59 0.55
60 0.57
61 0.61
62 0.66
63 0.64
64 0.61
65 0.54
66 0.59
67 0.58
68 0.62
69 0.62
70 0.57
71 0.51
72 0.51