Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1NSY6

Protein Details
Accession A0A0A1NSY6    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-37AKDDEGKRRTRQKKTTTGPKRGLSBasic
NLS Segment(s)
PositionSequence
13-29AAKDDEGKRRTRQKKTT
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MGKETTKVTRKAAAKDDEGKRRTRQKKTTTGPKRGLSAYMFFSQDNREVVKKENPNASFGEIGKLLGEKWKNMTDEQKKPYIEKAEADKKRYEEEKAAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.63
4 0.64
5 0.62
6 0.61
7 0.61
8 0.66
9 0.7
10 0.71
11 0.72
12 0.72
13 0.79
14 0.83
15 0.87
16 0.86
17 0.86
18 0.83
19 0.76
20 0.7
21 0.6
22 0.53
23 0.43
24 0.36
25 0.29
26 0.24
27 0.22
28 0.18
29 0.19
30 0.17
31 0.18
32 0.16
33 0.15
34 0.14
35 0.14
36 0.17
37 0.23
38 0.26
39 0.27
40 0.33
41 0.32
42 0.33
43 0.33
44 0.32
45 0.26
46 0.23
47 0.2
48 0.13
49 0.13
50 0.11
51 0.1
52 0.08
53 0.12
54 0.13
55 0.12
56 0.16
57 0.2
58 0.22
59 0.24
60 0.34
61 0.38
62 0.46
63 0.49
64 0.52
65 0.5
66 0.5
67 0.54
68 0.51
69 0.44
70 0.4
71 0.45
72 0.49
73 0.54
74 0.56
75 0.54
76 0.5
77 0.55
78 0.54
79 0.5
80 0.47