Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S386

Protein Details
Accession A0A1X0S386    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-57QTPKVAKQEKKKPKTGRAKKRQIYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
21-48RAGKVKSQTPKVAKQEKKKPKTGRAKKR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MHGDDLTFSFIIGKVHGSLARAGKVKSQTPKVAKQEKKKPKTGRAKKRQIYNRRFVNVTTQIGGKRRMNPAPTQGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.12
5 0.15
6 0.17
7 0.21
8 0.22
9 0.22
10 0.24
11 0.28
12 0.32
13 0.35
14 0.38
15 0.42
16 0.45
17 0.53
18 0.57
19 0.63
20 0.65
21 0.68
22 0.73
23 0.76
24 0.77
25 0.78
26 0.77
27 0.77
28 0.81
29 0.82
30 0.83
31 0.83
32 0.88
33 0.84
34 0.86
35 0.86
36 0.86
37 0.84
38 0.82
39 0.8
40 0.73
41 0.68
42 0.59
43 0.58
44 0.53
45 0.46
46 0.39
47 0.33
48 0.33
49 0.35
50 0.41
51 0.37
52 0.37
53 0.42
54 0.48
55 0.49
56 0.51