Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S2Y6

Protein Details
Accession A0A1X0S2Y6   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-33QNGRYSSTTGHRRRRRPHGKIRFERCVRGBasic
NLS Segment(s)
PositionSequence
15-28HRRRRRPHGKIRFE
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MLTLQNGRYSSTTGHRRRRRPHGKIRFERCVRGRTNARRTKTFPFISSQGHRLPISLTGFRVERGTESLFKADAVCNGTTPETRYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.69
4 0.77
5 0.85
6 0.87
7 0.87
8 0.89
9 0.89
10 0.91
11 0.92
12 0.91
13 0.9
14 0.82
15 0.8
16 0.73
17 0.69
18 0.6
19 0.58
20 0.59
21 0.58
22 0.66
23 0.65
24 0.65
25 0.63
26 0.64
27 0.62
28 0.6
29 0.52
30 0.43
31 0.39
32 0.38
33 0.37
34 0.35
35 0.33
36 0.27
37 0.28
38 0.27
39 0.23
40 0.21
41 0.2
42 0.21
43 0.19
44 0.17
45 0.17
46 0.17
47 0.18
48 0.18
49 0.14
50 0.12
51 0.14
52 0.17
53 0.17
54 0.19
55 0.2
56 0.19
57 0.19
58 0.19
59 0.17
60 0.17
61 0.18
62 0.16
63 0.15
64 0.17
65 0.19
66 0.19