Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S6T6

Protein Details
Accession A0A1X0S6T6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-98ISINGGKKYNKDRRKNTRKNCRRKKKKKEKRGBasic
NLS Segment(s)
PositionSequence
73-98KKYNKDRRKNTRKNCRRKKKKKEKRG
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MNKEGMKSVLLNISSTKATSLTQYHMYMAYIMANIRKILDFYGYETTEGRFRCYQGVQRTREEMVNISINGGKKYNKDRRKNTRKNCRRKKKKKEKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.12
5 0.12
6 0.15
7 0.16
8 0.17
9 0.21
10 0.21
11 0.21
12 0.2
13 0.2
14 0.17
15 0.15
16 0.11
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.08
24 0.08
25 0.08
26 0.1
27 0.09
28 0.11
29 0.15
30 0.14
31 0.15
32 0.15
33 0.15
34 0.16
35 0.16
36 0.17
37 0.14
38 0.14
39 0.16
40 0.18
41 0.24
42 0.3
43 0.38
44 0.39
45 0.4
46 0.42
47 0.41
48 0.4
49 0.35
50 0.26
51 0.21
52 0.2
53 0.18
54 0.16
55 0.17
56 0.17
57 0.17
58 0.18
59 0.18
60 0.2
61 0.31
62 0.41
63 0.48
64 0.58
65 0.67
66 0.77
67 0.86
68 0.92
69 0.92
70 0.93
71 0.94
72 0.95
73 0.96
74 0.96
75 0.96
76 0.96
77 0.97
78 0.97