Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WSD9

Protein Details
Accession J0WSD9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-96TPASTFTRRPRRTRRCIPAPPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_174983  -  
Amino Acid Sequences MVLLRTPLQNRPDQEQPTTRAGPILTLGIPLPHRSVHHPSDRRPVAATIPQPSGDHYRRYQDRTPTPSANKSSHTPASTFTRRPRRTRRCIPAPPLGMSDAVSAHGPQPAGDHVATALIYRHRSMTVPPITVTTPLSDILAHRVRCRWSIGPSLRPWRSEGRPRSRLPYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.52
4 0.53
5 0.51
6 0.45
7 0.38
8 0.34
9 0.28
10 0.23
11 0.2
12 0.13
13 0.12
14 0.12
15 0.12
16 0.14
17 0.14
18 0.14
19 0.14
20 0.16
21 0.21
22 0.28
23 0.32
24 0.41
25 0.46
26 0.49
27 0.58
28 0.59
29 0.54
30 0.49
31 0.44
32 0.38
33 0.38
34 0.36
35 0.29
36 0.29
37 0.28
38 0.26
39 0.27
40 0.31
41 0.28
42 0.29
43 0.27
44 0.34
45 0.38
46 0.44
47 0.47
48 0.48
49 0.53
50 0.55
51 0.59
52 0.56
53 0.56
54 0.56
55 0.55
56 0.48
57 0.43
58 0.39
59 0.38
60 0.36
61 0.33
62 0.27
63 0.25
64 0.3
65 0.32
66 0.34
67 0.37
68 0.44
69 0.49
70 0.57
71 0.66
72 0.68
73 0.74
74 0.79
75 0.81
76 0.8
77 0.82
78 0.79
79 0.76
80 0.68
81 0.6
82 0.51
83 0.42
84 0.32
85 0.25
86 0.2
87 0.11
88 0.09
89 0.08
90 0.07
91 0.07
92 0.08
93 0.07
94 0.07
95 0.08
96 0.08
97 0.1
98 0.1
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.09
105 0.09
106 0.11
107 0.11
108 0.12
109 0.13
110 0.13
111 0.15
112 0.22
113 0.24
114 0.24
115 0.24
116 0.25
117 0.25
118 0.26
119 0.25
120 0.17
121 0.14
122 0.13
123 0.13
124 0.11
125 0.11
126 0.17
127 0.23
128 0.23
129 0.24
130 0.29
131 0.31
132 0.33
133 0.38
134 0.35
135 0.33
136 0.42
137 0.47
138 0.5
139 0.55
140 0.64
141 0.61
142 0.59
143 0.58
144 0.56
145 0.58
146 0.61
147 0.63
148 0.63
149 0.69
150 0.72