Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0SBP6

Protein Details
Accession A0A1X0SBP6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-42RSYDEPKKGKSSKKSKPKLSRKRKAAGSEEBasic
NLS Segment(s)
PositionSequence
18-48PKKGKSSKKSKPKLSRKRKAAGSEEPSGSRK
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MTASLIQAFKSLRSYDEPKKGKSSKKSKPKLSRKRKAAGSEEPSGSRKRACPNASDFASSSAAQHAPAPPSQPSAAAVQPAALLQEFLRRLPPPPRSPPAPIISPLQKAVALSAASRAGSWFIRASCVSSTLSWNAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.48
4 0.52
5 0.52
6 0.61
7 0.65
8 0.68
9 0.71
10 0.73
11 0.73
12 0.78
13 0.84
14 0.86
15 0.89
16 0.92
17 0.92
18 0.93
19 0.93
20 0.91
21 0.9
22 0.86
23 0.83
24 0.79
25 0.77
26 0.72
27 0.66
28 0.59
29 0.53
30 0.48
31 0.42
32 0.36
33 0.29
34 0.27
35 0.28
36 0.35
37 0.34
38 0.36
39 0.4
40 0.45
41 0.44
42 0.41
43 0.35
44 0.29
45 0.29
46 0.25
47 0.19
48 0.14
49 0.13
50 0.12
51 0.12
52 0.11
53 0.1
54 0.11
55 0.12
56 0.11
57 0.13
58 0.12
59 0.12
60 0.12
61 0.12
62 0.12
63 0.11
64 0.1
65 0.09
66 0.09
67 0.08
68 0.07
69 0.05
70 0.05
71 0.04
72 0.09
73 0.09
74 0.1
75 0.13
76 0.13
77 0.17
78 0.24
79 0.32
80 0.35
81 0.42
82 0.48
83 0.49
84 0.53
85 0.56
86 0.53
87 0.47
88 0.42
89 0.4
90 0.39
91 0.37
92 0.33
93 0.28
94 0.24
95 0.21
96 0.2
97 0.17
98 0.13
99 0.11
100 0.12
101 0.12
102 0.12
103 0.12
104 0.12
105 0.11
106 0.11
107 0.13
108 0.14
109 0.14
110 0.17
111 0.18
112 0.2
113 0.19
114 0.21
115 0.21
116 0.19
117 0.23