Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S096

Protein Details
Accession A0A1X0S096    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-124FRQAVNKVRRIQRLKRNRGYAFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, E.R. 6, mito 5, extr 3, golg 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032630  P_typ_ATPase_c  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF16212  PhoLip_ATPase_C  
Amino Acid Sequences IWTKYTVIAIPGSMLIWFIYLPVVSYIGSAISVDIFPEYYGIVPMLWGNVNFWLFVLLVPFVCNLRDFIWKYAKRMYRPLPYHFVQEIQKYNLPDYRPRMDRFRQAVNKVRRIQRLKRNRGYAFSQNDSDQNKIIRVYDTTQQKPLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.06
5 0.05
6 0.06
7 0.05
8 0.06
9 0.06
10 0.07
11 0.07
12 0.07
13 0.07
14 0.06
15 0.07
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.07
43 0.08
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.14
54 0.15
55 0.18
56 0.28
57 0.29
58 0.31
59 0.37
60 0.4
61 0.37
62 0.43
63 0.45
64 0.45
65 0.48
66 0.5
67 0.48
68 0.45
69 0.47
70 0.4
71 0.37
72 0.3
73 0.3
74 0.29
75 0.27
76 0.29
77 0.25
78 0.27
79 0.27
80 0.26
81 0.28
82 0.31
83 0.34
84 0.37
85 0.39
86 0.45
87 0.46
88 0.53
89 0.52
90 0.56
91 0.57
92 0.58
93 0.65
94 0.67
95 0.71
96 0.69
97 0.72
98 0.72
99 0.73
100 0.75
101 0.76
102 0.78
103 0.8
104 0.82
105 0.84
106 0.78
107 0.75
108 0.72
109 0.71
110 0.67
111 0.6
112 0.54
113 0.46
114 0.49
115 0.46
116 0.42
117 0.36
118 0.31
119 0.28
120 0.27
121 0.26
122 0.23
123 0.23
124 0.24
125 0.29
126 0.36
127 0.38