Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0L7H7

Protein Details
Accession J0L7H7   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-137SSRATRTSHPRLRARRTRTRSKPPSPTNGPRARRPPEHydrophilic
NLS Segment(s)
PositionSequence
89-135GSRRRDDRGPTASSRATRTSHPRLRARRTRTRSKPPSPTNGPRARRP
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
KEGG adl:AURDEDRAFT_118171  -  
Amino Acid Sequences MPAAPRTGCGRVRVPQAMFASPSGRFVPRGHAPSSARTRPIDTAVQLAPGVRLEVPASHNDRSIVRATQSYVACGHGSRLPRLTDLRPGSRRRDDRGPTASSRATRTSHPRLRARRTRTRSKPPSPTNGPRARRPPELQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.46
4 0.43
5 0.39
6 0.34
7 0.3
8 0.24
9 0.26
10 0.21
11 0.19
12 0.2
13 0.19
14 0.25
15 0.29
16 0.33
17 0.31
18 0.35
19 0.36
20 0.42
21 0.5
22 0.46
23 0.43
24 0.41
25 0.42
26 0.38
27 0.39
28 0.34
29 0.26
30 0.25
31 0.22
32 0.21
33 0.18
34 0.16
35 0.13
36 0.1
37 0.1
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.13
44 0.17
45 0.17
46 0.17
47 0.18
48 0.18
49 0.19
50 0.19
51 0.16
52 0.13
53 0.13
54 0.14
55 0.18
56 0.17
57 0.16
58 0.15
59 0.15
60 0.14
61 0.13
62 0.13
63 0.11
64 0.13
65 0.13
66 0.15
67 0.15
68 0.17
69 0.2
70 0.2
71 0.26
72 0.29
73 0.35
74 0.39
75 0.43
76 0.48
77 0.54
78 0.57
79 0.55
80 0.6
81 0.56
82 0.58
83 0.59
84 0.56
85 0.5
86 0.5
87 0.48
88 0.41
89 0.4
90 0.36
91 0.32
92 0.33
93 0.39
94 0.45
95 0.49
96 0.55
97 0.61
98 0.67
99 0.75
100 0.8
101 0.8
102 0.81
103 0.82
104 0.84
105 0.85
106 0.87
107 0.87
108 0.87
109 0.89
110 0.86
111 0.88
112 0.86
113 0.85
114 0.85
115 0.84
116 0.8
117 0.79
118 0.8
119 0.77
120 0.76