Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0DAN3

Protein Details
Accession J0DAN3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
229-259RPVRGLRSRRHSPYRRPSKDKIQLDRKPKRDBasic
NLS Segment(s)
PositionSequence
228-258PRPVRGLRSRRHSPYRRPSKDKIQLDRKPKR
Subcellular Location(s) nucl 7.5, cyto_nucl 7.5, cyto 6.5, extr 5, mito 2, pero 2, vacu 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_147059  -  
Amino Acid Sequences MACLREDVRFQQVMHALLVAAQQAPTDGRPSNCELICAFFRGIGRPNDGCFHTHEVQDAPHECAGCGTAQHQFVESPDPRDGDDGAPFEDGDVYHEDDRHFPSPPATIATCTLPEPISPPAALPLSPSYVSPLLSDIDSDIEGPATPLDLDADLDAGLEVVYPVSPIATPLDLVLPPPTPSYTSMPRVMRVIDDEENEDQYMCPSPAPSLTSASASGSDESCPSPPSPRPVRGLRSRRHSPYRRPSKDKIQLDRKPKRDVGRAFEREVSLFVLDCFLVADLVYTPPVRAPEAFSTTRGGCDELFEYSSSSESESDSSASSTSSRASSPDVSHSPRFNPLSRAGRRVVQRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.21
4 0.19
5 0.2
6 0.14
7 0.1
8 0.09
9 0.08
10 0.09
11 0.1
12 0.1
13 0.14
14 0.16
15 0.17
16 0.22
17 0.27
18 0.34
19 0.32
20 0.33
21 0.29
22 0.31
23 0.31
24 0.3
25 0.25
26 0.2
27 0.21
28 0.23
29 0.28
30 0.27
31 0.31
32 0.3
33 0.32
34 0.33
35 0.33
36 0.31
37 0.3
38 0.34
39 0.31
40 0.3
41 0.29
42 0.27
43 0.26
44 0.31
45 0.28
46 0.24
47 0.23
48 0.22
49 0.2
50 0.19
51 0.19
52 0.13
53 0.12
54 0.1
55 0.13
56 0.15
57 0.15
58 0.16
59 0.15
60 0.16
61 0.24
62 0.24
63 0.23
64 0.24
65 0.24
66 0.24
67 0.25
68 0.25
69 0.18
70 0.2
71 0.17
72 0.15
73 0.15
74 0.14
75 0.13
76 0.12
77 0.1
78 0.1
79 0.11
80 0.12
81 0.13
82 0.15
83 0.15
84 0.17
85 0.22
86 0.21
87 0.21
88 0.18
89 0.19
90 0.2
91 0.2
92 0.21
93 0.17
94 0.17
95 0.16
96 0.17
97 0.17
98 0.15
99 0.16
100 0.12
101 0.12
102 0.13
103 0.13
104 0.13
105 0.11
106 0.11
107 0.12
108 0.12
109 0.12
110 0.12
111 0.11
112 0.13
113 0.13
114 0.13
115 0.14
116 0.14
117 0.14
118 0.13
119 0.12
120 0.1
121 0.1
122 0.1
123 0.07
124 0.07
125 0.07
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.05
157 0.05
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.07
164 0.08
165 0.08
166 0.08
167 0.11
168 0.14
169 0.18
170 0.21
171 0.26
172 0.27
173 0.27
174 0.27
175 0.24
176 0.21
177 0.19
178 0.19
179 0.15
180 0.15
181 0.16
182 0.16
183 0.16
184 0.16
185 0.14
186 0.1
187 0.09
188 0.1
189 0.07
190 0.07
191 0.06
192 0.07
193 0.08
194 0.09
195 0.1
196 0.11
197 0.12
198 0.13
199 0.13
200 0.13
201 0.12
202 0.12
203 0.11
204 0.09
205 0.09
206 0.09
207 0.1
208 0.1
209 0.11
210 0.11
211 0.14
212 0.17
213 0.25
214 0.3
215 0.34
216 0.4
217 0.45
218 0.52
219 0.58
220 0.64
221 0.63
222 0.66
223 0.69
224 0.71
225 0.76
226 0.77
227 0.77
228 0.79
229 0.83
230 0.83
231 0.83
232 0.82
233 0.82
234 0.84
235 0.82
236 0.81
237 0.8
238 0.79
239 0.82
240 0.85
241 0.79
242 0.77
243 0.74
244 0.71
245 0.7
246 0.68
247 0.65
248 0.67
249 0.65
250 0.6
251 0.57
252 0.51
253 0.42
254 0.37
255 0.3
256 0.19
257 0.15
258 0.12
259 0.1
260 0.09
261 0.08
262 0.07
263 0.06
264 0.05
265 0.05
266 0.05
267 0.05
268 0.06
269 0.08
270 0.07
271 0.08
272 0.09
273 0.11
274 0.12
275 0.12
276 0.17
277 0.21
278 0.27
279 0.28
280 0.28
281 0.31
282 0.29
283 0.31
284 0.27
285 0.23
286 0.16
287 0.18
288 0.18
289 0.16
290 0.16
291 0.15
292 0.15
293 0.14
294 0.15
295 0.13
296 0.13
297 0.11
298 0.11
299 0.12
300 0.12
301 0.12
302 0.12
303 0.12
304 0.11
305 0.11
306 0.11
307 0.11
308 0.12
309 0.12
310 0.12
311 0.13
312 0.18
313 0.22
314 0.24
315 0.3
316 0.35
317 0.4
318 0.45
319 0.47
320 0.46
321 0.5
322 0.52
323 0.48
324 0.47
325 0.5
326 0.54
327 0.56
328 0.59
329 0.54
330 0.56
331 0.6