Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D5Z3

Protein Details
Accession J0D5Z3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-31RSVSAVLKRRKDTRKKDEPAHKVLAHydrophilic
NLS Segment(s)
PositionSequence
15-21RRKDTRK
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
KEGG adl:AURDEDRAFT_176682  -  
Amino Acid Sequences MLISQLRSVSAVLKRRKDTRKKDEPAHKVLASTGYDIDHLDERWALQRAAELSVRSHPTKKLKKSLDAGLQLQEQVDAIDESIRSTRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.68
4 0.73
5 0.78
6 0.8
7 0.83
8 0.83
9 0.87
10 0.87
11 0.85
12 0.81
13 0.76
14 0.66
15 0.55
16 0.47
17 0.41
18 0.31
19 0.24
20 0.18
21 0.12
22 0.12
23 0.11
24 0.12
25 0.09
26 0.08
27 0.08
28 0.07
29 0.07
30 0.1
31 0.11
32 0.1
33 0.09
34 0.1
35 0.11
36 0.13
37 0.14
38 0.11
39 0.11
40 0.16
41 0.2
42 0.2
43 0.21
44 0.26
45 0.35
46 0.44
47 0.5
48 0.56
49 0.58
50 0.63
51 0.66
52 0.68
53 0.65
54 0.61
55 0.55
56 0.48
57 0.44
58 0.36
59 0.31
60 0.24
61 0.15
62 0.1
63 0.1
64 0.07
65 0.06
66 0.08
67 0.08
68 0.09
69 0.14