Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0SG63

Protein Details
Accession A0A1X0SG63    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-43ANKAIRQERQPIKRRLKPMVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, plas 6, mito 1, cyto 1, pero 1, E.R. 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYVLEEHNDIDKLSLRLSNLIHEANKAIRQERQPIKRRLKPMVQAKQHDQLTHSFNRLNTSIAEVRDLSRGLTSIRQVDILLLLLCVPLLHIPSTIVSLLLDLVSFQDEHSGLIWILLLGLSLFIITQLKEQTEGTVIRKRPKSVSLPIRNSMKPIIEQRRYSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.2
4 0.21
5 0.23
6 0.22
7 0.25
8 0.24
9 0.22
10 0.24
11 0.23
12 0.27
13 0.26
14 0.25
15 0.28
16 0.31
17 0.4
18 0.48
19 0.55
20 0.6
21 0.68
22 0.76
23 0.77
24 0.8
25 0.78
26 0.77
27 0.76
28 0.77
29 0.77
30 0.74
31 0.72
32 0.7
33 0.7
34 0.64
35 0.55
36 0.46
37 0.4
38 0.38
39 0.35
40 0.32
41 0.26
42 0.25
43 0.27
44 0.26
45 0.23
46 0.18
47 0.2
48 0.2
49 0.18
50 0.19
51 0.16
52 0.17
53 0.17
54 0.17
55 0.12
56 0.09
57 0.09
58 0.09
59 0.1
60 0.11
61 0.11
62 0.11
63 0.11
64 0.11
65 0.1
66 0.1
67 0.08
68 0.07
69 0.05
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.06
95 0.06
96 0.06
97 0.07
98 0.08
99 0.07
100 0.07
101 0.07
102 0.05
103 0.05
104 0.04
105 0.04
106 0.02
107 0.03
108 0.02
109 0.02
110 0.02
111 0.03
112 0.04
113 0.04
114 0.07
115 0.08
116 0.09
117 0.11
118 0.11
119 0.12
120 0.15
121 0.17
122 0.2
123 0.26
124 0.3
125 0.38
126 0.43
127 0.45
128 0.46
129 0.51
130 0.54
131 0.56
132 0.63
133 0.65
134 0.67
135 0.7
136 0.73
137 0.66
138 0.62
139 0.56
140 0.48
141 0.44
142 0.47
143 0.51
144 0.52