Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RP60

Protein Details
Accession A0A1X0RP60    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
124-151APYTLAHRTNSKKRKKVKNTFKKASGIVHydrophilic
NLS Segment(s)
PositionSequence
134-147SKKRKKVKNTFKKA
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MTIKNIVDIFVATDCSASEAVDKKTIKEKTTKFSNVEYKMRSGFEWARKVELKNREAADMQQVYSEIPVVNSVNSNELLKYLRVIGGNRKSYRHRETKAYLVQNRQVADNHMCDLVLGQTAAGAPYTLAHRTNSKKRKKVKNTFKKASGIVAKEVKRTVIAYGDASLTETKARYAPMLVNIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.1
4 0.09
5 0.12
6 0.15
7 0.17
8 0.25
9 0.25
10 0.26
11 0.35
12 0.39
13 0.39
14 0.44
15 0.47
16 0.48
17 0.58
18 0.61
19 0.56
20 0.59
21 0.64
22 0.61
23 0.63
24 0.57
25 0.51
26 0.47
27 0.45
28 0.37
29 0.34
30 0.35
31 0.36
32 0.4
33 0.37
34 0.4
35 0.42
36 0.45
37 0.46
38 0.48
39 0.42
40 0.41
41 0.41
42 0.38
43 0.36
44 0.34
45 0.34
46 0.26
47 0.24
48 0.18
49 0.17
50 0.15
51 0.14
52 0.14
53 0.07
54 0.05
55 0.07
56 0.06
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.09
63 0.08
64 0.09
65 0.1
66 0.09
67 0.09
68 0.08
69 0.09
70 0.1
71 0.11
72 0.18
73 0.24
74 0.31
75 0.32
76 0.35
77 0.37
78 0.44
79 0.5
80 0.5
81 0.46
82 0.46
83 0.48
84 0.52
85 0.55
86 0.56
87 0.52
88 0.48
89 0.49
90 0.45
91 0.43
92 0.36
93 0.29
94 0.25
95 0.24
96 0.21
97 0.18
98 0.15
99 0.14
100 0.12
101 0.12
102 0.09
103 0.07
104 0.05
105 0.04
106 0.04
107 0.04
108 0.05
109 0.04
110 0.03
111 0.03
112 0.04
113 0.06
114 0.08
115 0.09
116 0.11
117 0.18
118 0.26
119 0.37
120 0.46
121 0.54
122 0.62
123 0.71
124 0.8
125 0.85
126 0.89
127 0.89
128 0.91
129 0.92
130 0.92
131 0.88
132 0.82
133 0.72
134 0.69
135 0.64
136 0.55
137 0.51
138 0.5
139 0.45
140 0.44
141 0.43
142 0.36
143 0.3
144 0.29
145 0.24
146 0.2
147 0.19
148 0.17
149 0.17
150 0.17
151 0.15
152 0.16
153 0.15
154 0.12
155 0.13
156 0.12
157 0.13
158 0.14
159 0.15
160 0.15
161 0.17
162 0.2