Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0WNT7

Protein Details
Accession J0WNT7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTRNHPKKYRKTIARMTTGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto_mito 13.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_177413  -  
Amino Acid Sequences MTRNHPKKYRKTIARMTTGGVPPGIHGVAFLINRRRARLAQWLGRNNVLTRSEHRQLEADYAQLSGSGYEYNTQINRFVHPLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.74
3 0.65
4 0.61
5 0.53
6 0.44
7 0.34
8 0.25
9 0.18
10 0.19
11 0.16
12 0.09
13 0.07
14 0.07
15 0.09
16 0.1
17 0.12
18 0.16
19 0.22
20 0.23
21 0.25
22 0.27
23 0.25
24 0.27
25 0.34
26 0.35
27 0.36
28 0.42
29 0.45
30 0.44
31 0.45
32 0.43
33 0.33
34 0.31
35 0.26
36 0.21
37 0.2
38 0.26
39 0.3
40 0.29
41 0.3
42 0.28
43 0.27
44 0.3
45 0.27
46 0.21
47 0.16
48 0.16
49 0.14
50 0.12
51 0.11
52 0.06
53 0.07
54 0.06
55 0.06
56 0.08
57 0.09
58 0.13
59 0.15
60 0.16
61 0.2
62 0.2
63 0.23