Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RXQ7

Protein Details
Accession A0A1X0RXQ7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-38IPKTRNTYCKGAKCRKHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MILLLWMTKVNIPKTRNTYCKGAKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKYKMQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.59
4 0.58
5 0.61
6 0.62
7 0.7
8 0.72
9 0.74
10 0.74
11 0.76
12 0.82
13 0.83
14 0.85
15 0.86
16 0.85
17 0.85
18 0.87
19 0.87
20 0.79
21 0.79
22 0.76
23 0.69
24 0.63
25 0.55
26 0.44
27 0.37
28 0.36
29 0.34
30 0.3
31 0.27
32 0.33
33 0.36
34 0.4
35 0.45
36 0.49
37 0.46
38 0.52
39 0.6
40 0.57
41 0.59
42 0.57
43 0.56
44 0.55
45 0.57
46 0.48
47 0.43
48 0.4
49 0.33
50 0.35
51 0.37
52 0.36
53 0.31
54 0.38
55 0.42
56 0.51
57 0.6
58 0.63
59 0.62
60 0.66
61 0.72
62 0.73
63 0.72
64 0.68
65 0.63
66 0.6
67 0.59
68 0.53
69 0.49
70 0.46
71 0.4
72 0.34
73 0.32
74 0.31
75 0.35
76 0.41
77 0.43
78 0.46
79 0.56
80 0.63
81 0.68
82 0.66
83 0.6
84 0.55
85 0.51
86 0.49
87 0.5
88 0.5
89 0.51
90 0.54
91 0.52
92 0.49
93 0.49
94 0.42