Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S366

Protein Details
Accession A0A1X0S366    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
139-173LINGGKTYYKDRRKKKQGRKKKDSIKFKRHRAGVABasic
NLS Segment(s)
PositionSequence
148-174KDRRKKKQGRKKKDSIKFKRHRAGVAG
178-178K
181-181K
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MMSKKKTSFVQVAAKRGTRLQGLPYAQIEISTQNLWYSISQLVLGKTPTRSRFQTASLAAGKVSQVDTKDPIARYSQCLNSACTEVATCYNNMIVECFQSKFMSYVVCTIRMSVNQKEPPYILSVKPFERAREEQINILINGGKTYYKDRRKKKQGRKKKDSIKFKRHRAGVAGVLYKALKIRKRQENAIVVTVEELRISRVKRYSLILNILLNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.49
4 0.45
5 0.39
6 0.36
7 0.32
8 0.34
9 0.33
10 0.35
11 0.33
12 0.32
13 0.27
14 0.26
15 0.22
16 0.16
17 0.16
18 0.13
19 0.12
20 0.1
21 0.11
22 0.12
23 0.11
24 0.12
25 0.1
26 0.1
27 0.11
28 0.12
29 0.13
30 0.14
31 0.15
32 0.15
33 0.18
34 0.25
35 0.27
36 0.31
37 0.33
38 0.37
39 0.38
40 0.39
41 0.42
42 0.37
43 0.38
44 0.35
45 0.32
46 0.26
47 0.24
48 0.2
49 0.14
50 0.14
51 0.1
52 0.1
53 0.11
54 0.14
55 0.16
56 0.2
57 0.2
58 0.2
59 0.23
60 0.23
61 0.25
62 0.27
63 0.27
64 0.28
65 0.29
66 0.29
67 0.26
68 0.26
69 0.22
70 0.18
71 0.15
72 0.11
73 0.12
74 0.12
75 0.1
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.07
82 0.08
83 0.09
84 0.09
85 0.1
86 0.09
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.12
93 0.12
94 0.14
95 0.13
96 0.13
97 0.14
98 0.16
99 0.2
100 0.18
101 0.24
102 0.26
103 0.27
104 0.27
105 0.27
106 0.24
107 0.24
108 0.23
109 0.17
110 0.18
111 0.21
112 0.21
113 0.26
114 0.26
115 0.24
116 0.28
117 0.3
118 0.32
119 0.35
120 0.35
121 0.31
122 0.33
123 0.33
124 0.26
125 0.25
126 0.2
127 0.13
128 0.12
129 0.11
130 0.09
131 0.08
132 0.16
133 0.25
134 0.34
135 0.43
136 0.53
137 0.63
138 0.75
139 0.84
140 0.89
141 0.9
142 0.92
143 0.94
144 0.95
145 0.94
146 0.94
147 0.93
148 0.93
149 0.92
150 0.92
151 0.91
152 0.9
153 0.88
154 0.81
155 0.75
156 0.68
157 0.61
158 0.56
159 0.52
160 0.44
161 0.35
162 0.32
163 0.29
164 0.25
165 0.24
166 0.24
167 0.24
168 0.31
169 0.41
170 0.5
171 0.56
172 0.62
173 0.68
174 0.7
175 0.68
176 0.64
177 0.54
178 0.44
179 0.4
180 0.33
181 0.24
182 0.16
183 0.12
184 0.11
185 0.15
186 0.17
187 0.22
188 0.26
189 0.29
190 0.32
191 0.36
192 0.4
193 0.42
194 0.46
195 0.43