Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RXT1

Protein Details
Accession A0A1X0RXT1    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
189-214YHKSLKHLYVKTKPKKRDRDPGITTGBasic
NLS Segment(s)
PositionSequence
173-174KR
199-207KTKPKKRDR
235-243RQGSKKSKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027973  DUF4602  
Pfam View protein in Pfam  
PF15375  DUF4602  
Amino Acid Sequences MSSLASLINNIKANTAHNPLVQKNQKRKTTADSNAKQKKTKTMEEPKSNGPTVVVFDGSILERKPLFEDKSEKRRFMASITEYIVTLPDKPEQKQPAMTPQELEEEAENERHDVELKQLLATSKLLEELEREEMTSKERRRHTLQKLETLGAKPTPKEKMPLPLKLKVNEAHKRRNLEKLQEAKDLGIYHKSLKHLYVKTKPKKRDRDPGITTGVGKMKGATLTLRKSDIQRIQRQGSKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.29
4 0.29
5 0.34
6 0.35
7 0.45
8 0.51
9 0.55
10 0.6
11 0.67
12 0.71
13 0.7
14 0.71
15 0.69
16 0.7
17 0.7
18 0.71
19 0.69
20 0.73
21 0.78
22 0.79
23 0.76
24 0.69
25 0.69
26 0.65
27 0.65
28 0.65
29 0.66
30 0.71
31 0.75
32 0.77
33 0.74
34 0.72
35 0.65
36 0.54
37 0.44
38 0.34
39 0.28
40 0.24
41 0.17
42 0.11
43 0.1
44 0.11
45 0.11
46 0.12
47 0.1
48 0.1
49 0.1
50 0.11
51 0.14
52 0.19
53 0.2
54 0.23
55 0.32
56 0.38
57 0.49
58 0.54
59 0.52
60 0.48
61 0.48
62 0.44
63 0.38
64 0.37
65 0.29
66 0.27
67 0.28
68 0.27
69 0.24
70 0.23
71 0.22
72 0.14
73 0.12
74 0.1
75 0.12
76 0.15
77 0.16
78 0.24
79 0.27
80 0.28
81 0.31
82 0.31
83 0.36
84 0.38
85 0.37
86 0.3
87 0.27
88 0.28
89 0.24
90 0.23
91 0.14
92 0.1
93 0.11
94 0.11
95 0.1
96 0.08
97 0.08
98 0.07
99 0.08
100 0.07
101 0.08
102 0.1
103 0.1
104 0.1
105 0.11
106 0.11
107 0.11
108 0.11
109 0.09
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.11
117 0.1
118 0.1
119 0.1
120 0.11
121 0.14
122 0.21
123 0.22
124 0.27
125 0.31
126 0.36
127 0.43
128 0.52
129 0.58
130 0.61
131 0.62
132 0.62
133 0.61
134 0.57
135 0.52
136 0.43
137 0.36
138 0.29
139 0.26
140 0.2
141 0.21
142 0.24
143 0.23
144 0.25
145 0.25
146 0.32
147 0.36
148 0.45
149 0.46
150 0.49
151 0.52
152 0.51
153 0.53
154 0.47
155 0.51
156 0.5
157 0.52
158 0.54
159 0.55
160 0.6
161 0.59
162 0.64
163 0.6
164 0.59
165 0.62
166 0.61
167 0.6
168 0.58
169 0.56
170 0.46
171 0.43
172 0.37
173 0.29
174 0.24
175 0.2
176 0.2
177 0.22
178 0.25
179 0.23
180 0.26
181 0.33
182 0.36
183 0.43
184 0.49
185 0.57
186 0.65
187 0.73
188 0.79
189 0.81
190 0.86
191 0.87
192 0.88
193 0.86
194 0.86
195 0.83
196 0.79
197 0.74
198 0.64
199 0.56
200 0.5
201 0.45
202 0.35
203 0.28
204 0.23
205 0.19
206 0.18
207 0.19
208 0.19
209 0.22
210 0.27
211 0.31
212 0.33
213 0.34
214 0.37
215 0.46
216 0.5
217 0.53
218 0.57
219 0.62
220 0.67
221 0.71
222 0.73
223 0.74