Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D753

Protein Details
Accession J0D753    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-40VDPGPARRRSRHGRDRGRGPAYKBasic
NLS Segment(s)
PositionSequence
23-38ARRRSRHGRDRGRGPA
Subcellular Location(s) extr 13, mito 8, cyto 4
Family & Domain DBs
KEGG adl:AURDEDRAFT_176137  -  
Amino Acid Sequences MQSAATGTVWPAAGLAVVDPGPARRRSRHGRDRGRGPAYKRSHCGQCGTSVCSGDDIDTPAVVVTTLAGDAFNVKGHIFVGSTRAPEGGIARVVDDGRPRWVKWPRSPEGAWTPPPQDSELQTKILDVENGTAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.06
6 0.06
7 0.09
8 0.14
9 0.2
10 0.24
11 0.28
12 0.37
13 0.47
14 0.58
15 0.65
16 0.71
17 0.76
18 0.81
19 0.85
20 0.85
21 0.82
22 0.76
23 0.71
24 0.7
25 0.67
26 0.63
27 0.59
28 0.55
29 0.54
30 0.5
31 0.5
32 0.41
33 0.4
34 0.37
35 0.36
36 0.32
37 0.27
38 0.24
39 0.21
40 0.2
41 0.14
42 0.11
43 0.1
44 0.09
45 0.08
46 0.07
47 0.06
48 0.06
49 0.05
50 0.04
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.02
57 0.03
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.05
66 0.05
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.11
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.11
82 0.13
83 0.13
84 0.19
85 0.21
86 0.22
87 0.29
88 0.38
89 0.45
90 0.51
91 0.6
92 0.58
93 0.62
94 0.62
95 0.6
96 0.61
97 0.58
98 0.54
99 0.48
100 0.46
101 0.41
102 0.43
103 0.38
104 0.32
105 0.29
106 0.33
107 0.31
108 0.31
109 0.29
110 0.27
111 0.27
112 0.26
113 0.23
114 0.16