Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D715

Protein Details
Accession J0D715    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
255-298FGAGPSSAKKKHKKDPSLSPDPTPPPPPLPKRPHKSSAKLLFDEHydrophilic
NLS Segment(s)
PositionSequence
241-290PKLSRKHSRAAEESFGAGPSSAKKKHKKDPSLSPDPTPPPPPLPKRPHKS
Subcellular Location(s) extr 8, cyto 7.5, cyto_nucl 7.5, nucl 6.5, mito 5
Family & Domain DBs
KEGG adl:AURDEDRAFT_176235  -  
Amino Acid Sequences MGKQSILDVSSPPKAVSSAAACAASSESSPLPLPLPSPAAAGGNSDTDVPSLPAGSSAIPSVLSGGFGSPTLLVTPSAALVPTTTPTTPAGIVATARSSEGDGDDDAAVLAVLAADGDNAVGKEPAAGGALMPLVPVPQPTSLMTWPAGEPSYERIQHWCRTLAAAVDHFNRLSTSLAPSTGLRRLVIALRNRYGRQLAFEHDGSDALEGSAANEPEVCRTPPSGSPSLIGTPARRVSPLPKLSRKHSRAAEESFGAGPSSAKKKHKKDPSLSPDPTPPPPPLPKRPHKSSAKLLFDEDMKRRNWHNDSIGGEKKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.2
5 0.18
6 0.2
7 0.2
8 0.19
9 0.19
10 0.19
11 0.16
12 0.13
13 0.13
14 0.1
15 0.12
16 0.13
17 0.13
18 0.13
19 0.13
20 0.13
21 0.13
22 0.16
23 0.15
24 0.16
25 0.15
26 0.16
27 0.15
28 0.16
29 0.14
30 0.12
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.08
70 0.1
71 0.09
72 0.11
73 0.11
74 0.13
75 0.12
76 0.12
77 0.11
78 0.09
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.07
90 0.08
91 0.08
92 0.08
93 0.07
94 0.06
95 0.05
96 0.04
97 0.04
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.03
121 0.03
122 0.04
123 0.04
124 0.05
125 0.05
126 0.07
127 0.08
128 0.11
129 0.11
130 0.12
131 0.12
132 0.12
133 0.11
134 0.11
135 0.11
136 0.08
137 0.08
138 0.11
139 0.14
140 0.15
141 0.15
142 0.19
143 0.23
144 0.26
145 0.28
146 0.25
147 0.21
148 0.21
149 0.21
150 0.17
151 0.14
152 0.12
153 0.13
154 0.12
155 0.13
156 0.12
157 0.12
158 0.1
159 0.1
160 0.1
161 0.08
162 0.09
163 0.09
164 0.1
165 0.1
166 0.11
167 0.13
168 0.15
169 0.15
170 0.12
171 0.12
172 0.13
173 0.16
174 0.2
175 0.24
176 0.25
177 0.28
178 0.32
179 0.32
180 0.33
181 0.32
182 0.27
183 0.25
184 0.23
185 0.23
186 0.23
187 0.23
188 0.21
189 0.19
190 0.19
191 0.15
192 0.13
193 0.1
194 0.06
195 0.06
196 0.05
197 0.06
198 0.08
199 0.08
200 0.07
201 0.08
202 0.08
203 0.11
204 0.13
205 0.13
206 0.12
207 0.14
208 0.16
209 0.2
210 0.26
211 0.27
212 0.25
213 0.25
214 0.26
215 0.26
216 0.26
217 0.23
218 0.18
219 0.2
220 0.22
221 0.22
222 0.21
223 0.21
224 0.24
225 0.32
226 0.4
227 0.44
228 0.5
229 0.54
230 0.61
231 0.7
232 0.69
233 0.68
234 0.66
235 0.64
236 0.62
237 0.62
238 0.58
239 0.48
240 0.46
241 0.38
242 0.31
243 0.24
244 0.18
245 0.13
246 0.14
247 0.21
248 0.26
249 0.35
250 0.45
251 0.53
252 0.63
253 0.73
254 0.79
255 0.8
256 0.84
257 0.85
258 0.86
259 0.8
260 0.74
261 0.71
262 0.66
263 0.62
264 0.54
265 0.48
266 0.45
267 0.51
268 0.56
269 0.59
270 0.64
271 0.7
272 0.76
273 0.81
274 0.83
275 0.83
276 0.83
277 0.83
278 0.83
279 0.8
280 0.73
281 0.67
282 0.6
283 0.55
284 0.55
285 0.5
286 0.46
287 0.4
288 0.43
289 0.45
290 0.52
291 0.53
292 0.53
293 0.53
294 0.53
295 0.55
296 0.6
297 0.61