Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0D2J1

Protein Details
Accession J0D2J1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-102VVLKAPTKARRTRRPVRSHPEEKEQPPHydrophilic
NLS Segment(s)
PositionSequence
83-90KARRTRRP
Subcellular Location(s) nucl 13.5, cyto_nucl 10.666, mito_nucl 9.499, cyto 5.5, cyto_mito 5.499, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG adl:AURDEDRAFT_25357  -  
CDD cd00303  retropepsin_like  
Amino Acid Sequences ITMQSANSTKDKTLGLCANLEVRIFGIPFYLQAHVVEEAPFDLLLGRPFFALADSSEVSMPDGETVIVLKDPNSDVVLKAPTKARRTRRPVRSHPEEKEQPPAQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.25
4 0.26
5 0.25
6 0.24
7 0.23
8 0.16
9 0.12
10 0.12
11 0.1
12 0.09
13 0.08
14 0.07
15 0.08
16 0.09
17 0.1
18 0.09
19 0.09
20 0.11
21 0.11
22 0.11
23 0.1
24 0.09
25 0.08
26 0.08
27 0.07
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.09
61 0.1
62 0.1
63 0.12
64 0.17
65 0.15
66 0.18
67 0.23
68 0.29
69 0.36
70 0.45
71 0.52
72 0.58
73 0.68
74 0.76
75 0.8
76 0.83
77 0.86
78 0.88
79 0.88
80 0.88
81 0.85
82 0.85
83 0.83
84 0.75
85 0.75