Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RXA7

Protein Details
Accession A0A1X0RXA7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-60TLIKILFKKCKKKLESCRIVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRKVGTDALKGITCKYPNVSRKTMERVRVYSVHAIQKPMTLIKILFKKCKKKLESCRIVIQLYCYWSLKKENS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.35
4 0.4
5 0.46
6 0.48
7 0.45
8 0.49
9 0.57
10 0.57
11 0.56
12 0.53
13 0.49
14 0.49
15 0.47
16 0.44
17 0.4
18 0.38
19 0.37
20 0.32
21 0.31
22 0.27
23 0.26
24 0.24
25 0.2
26 0.16
27 0.1
28 0.09
29 0.14
30 0.21
31 0.24
32 0.32
33 0.39
34 0.49
35 0.56
36 0.65
37 0.67
38 0.7
39 0.77
40 0.8
41 0.82
42 0.77
43 0.77
44 0.71
45 0.66
46 0.56
47 0.49
48 0.41
49 0.34
50 0.33
51 0.26
52 0.24
53 0.25