Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RK31

Protein Details
Accession A0A1X0RK31   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
301-328MYTRKNDDLRGSKKRRRRNDDDDDTRAEBasic
NLS Segment(s)
PositionSequence
311-318GSKKRRRR
Subcellular Location(s) plas 6, E.R. 6, nucl 4, mito 3, cyto_nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR002058  PAP_assoc  
IPR002934  Polymerase_NTP_transf_dom  
IPR045862  Trf4-like  
Gene Ontology GO:0031499  C:TRAMP complex  
GO:0046872  F:metal ion binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0031123  P:RNA 3'-end processing  
GO:0043631  P:RNA polyadenylation  
Pfam View protein in Pfam  
PF01909  NTP_transf_2  
PF03828  PAP_assoc  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MIQRLIESMFSPMPVVEAFGSFVTSLALPSSDVDIVIRFDKPVMPRNILNRIYREAKRRFIFKRSEFIRAAKTPIITGCLRNGVSVDISVQGNVTSSERTVTWIKEYPELKPLFMVLKQSLSAFRLRNVWTFEPLSAKTAGLCNFGLICLIVSYLQLHKPTDITSTDPEYYGRLLLGLLDYYAHDFDASMHIISVSNEGKYYPMREMNNVLGDYYYESGKLFIINPDEPGRNVTAALQHFDYLQLIFKTASSLLKSRLSKKGSVSILSSIIKVETRYGEKQRKELDDFMVDYIYANMDETMYTRKNDDLRGSKKRRRRNDDDDDTRAEERVGKHIRFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.1
4 0.09
5 0.11
6 0.1
7 0.11
8 0.1
9 0.1
10 0.09
11 0.08
12 0.08
13 0.07
14 0.08
15 0.07
16 0.08
17 0.11
18 0.1
19 0.1
20 0.1
21 0.1
22 0.12
23 0.13
24 0.13
25 0.11
26 0.12
27 0.16
28 0.2
29 0.28
30 0.32
31 0.35
32 0.38
33 0.45
34 0.53
35 0.55
36 0.55
37 0.5
38 0.51
39 0.54
40 0.55
41 0.59
42 0.56
43 0.6
44 0.6
45 0.65
46 0.64
47 0.65
48 0.69
49 0.64
50 0.67
51 0.62
52 0.65
53 0.59
54 0.57
55 0.56
56 0.48
57 0.47
58 0.4
59 0.37
60 0.3
61 0.28
62 0.29
63 0.22
64 0.22
65 0.2
66 0.22
67 0.21
68 0.2
69 0.2
70 0.16
71 0.15
72 0.14
73 0.12
74 0.1
75 0.1
76 0.1
77 0.09
78 0.08
79 0.08
80 0.08
81 0.09
82 0.07
83 0.07
84 0.08
85 0.08
86 0.12
87 0.14
88 0.14
89 0.18
90 0.21
91 0.23
92 0.29
93 0.3
94 0.28
95 0.34
96 0.33
97 0.29
98 0.24
99 0.24
100 0.19
101 0.2
102 0.21
103 0.14
104 0.14
105 0.15
106 0.15
107 0.16
108 0.15
109 0.19
110 0.16
111 0.17
112 0.21
113 0.22
114 0.25
115 0.28
116 0.28
117 0.26
118 0.27
119 0.26
120 0.24
121 0.23
122 0.22
123 0.17
124 0.16
125 0.13
126 0.15
127 0.15
128 0.14
129 0.13
130 0.12
131 0.11
132 0.11
133 0.1
134 0.07
135 0.06
136 0.03
137 0.04
138 0.03
139 0.04
140 0.05
141 0.06
142 0.08
143 0.1
144 0.1
145 0.1
146 0.11
147 0.11
148 0.13
149 0.12
150 0.13
151 0.13
152 0.16
153 0.16
154 0.16
155 0.16
156 0.14
157 0.13
158 0.11
159 0.09
160 0.06
161 0.05
162 0.05
163 0.05
164 0.04
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.07
175 0.07
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.1
182 0.09
183 0.08
184 0.08
185 0.09
186 0.1
187 0.1
188 0.12
189 0.12
190 0.17
191 0.18
192 0.2
193 0.22
194 0.24
195 0.26
196 0.24
197 0.21
198 0.15
199 0.14
200 0.14
201 0.12
202 0.09
203 0.06
204 0.07
205 0.07
206 0.07
207 0.08
208 0.07
209 0.09
210 0.13
211 0.13
212 0.15
213 0.18
214 0.19
215 0.18
216 0.2
217 0.19
218 0.15
219 0.15
220 0.13
221 0.15
222 0.15
223 0.17
224 0.16
225 0.15
226 0.14
227 0.15
228 0.14
229 0.09
230 0.11
231 0.09
232 0.1
233 0.1
234 0.09
235 0.11
236 0.11
237 0.14
238 0.14
239 0.16
240 0.19
241 0.26
242 0.3
243 0.35
244 0.42
245 0.43
246 0.44
247 0.46
248 0.5
249 0.46
250 0.44
251 0.4
252 0.34
253 0.35
254 0.31
255 0.28
256 0.2
257 0.18
258 0.17
259 0.15
260 0.15
261 0.15
262 0.2
263 0.27
264 0.37
265 0.45
266 0.47
267 0.54
268 0.59
269 0.61
270 0.61
271 0.58
272 0.52
273 0.48
274 0.46
275 0.39
276 0.32
277 0.25
278 0.21
279 0.17
280 0.13
281 0.09
282 0.08
283 0.07
284 0.06
285 0.07
286 0.08
287 0.14
288 0.16
289 0.17
290 0.18
291 0.22
292 0.26
293 0.31
294 0.39
295 0.42
296 0.49
297 0.6
298 0.68
299 0.73
300 0.79
301 0.84
302 0.86
303 0.86
304 0.87
305 0.87
306 0.87
307 0.9
308 0.89
309 0.85
310 0.79
311 0.73
312 0.64
313 0.54
314 0.44
315 0.37
316 0.3
317 0.34
318 0.37