Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WU42

Protein Details
Accession J0WU42   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-110DVRPAKPVYRPRRSRTNGKAQKGKAKAKQHydrophilic
NLS Segment(s)
PositionSequence
87-110KPVYRPRRSRTNGKAQKGKAKAKQ
Subcellular Location(s) mito 15.5, cyto_mito 9, nucl 8
Family & Domain DBs
KEGG adl:AURDEDRAFT_116900  -  
Amino Acid Sequences MLEQLRKIRRDIRERDHDSCVWCGVLRLARGRDYLKVHLDRGKCPVFHELAKRGMLGDWNALHRGEAHERDHWQLDSDLAQDVRPAKPVYRPRRSRTNGKAQKGKAKAKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.73
4 0.67
5 0.6
6 0.52
7 0.43
8 0.33
9 0.25
10 0.21
11 0.18
12 0.19
13 0.18
14 0.22
15 0.23
16 0.24
17 0.27
18 0.28
19 0.29
20 0.3
21 0.32
22 0.33
23 0.34
24 0.34
25 0.37
26 0.38
27 0.35
28 0.37
29 0.36
30 0.29
31 0.28
32 0.29
33 0.26
34 0.27
35 0.3
36 0.27
37 0.27
38 0.28
39 0.25
40 0.22
41 0.2
42 0.17
43 0.13
44 0.11
45 0.09
46 0.1
47 0.11
48 0.1
49 0.1
50 0.1
51 0.12
52 0.15
53 0.17
54 0.19
55 0.21
56 0.23
57 0.25
58 0.27
59 0.24
60 0.21
61 0.18
62 0.16
63 0.14
64 0.13
65 0.13
66 0.11
67 0.11
68 0.11
69 0.13
70 0.13
71 0.16
72 0.17
73 0.17
74 0.25
75 0.36
76 0.44
77 0.53
78 0.61
79 0.64
80 0.74
81 0.79
82 0.81
83 0.8
84 0.81
85 0.8
86 0.82
87 0.85
88 0.8
89 0.83
90 0.82