Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RSK1

Protein Details
Accession A0A1X0RSK1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKRKKDNDPPPPKPKRNKGKAVDRGFPSBasic
NLS Segment(s)
PositionSequence
2-21KRKKDNDPPPPKPKRNKGKA
Subcellular Location(s) nucl 22, mito_nucl 12.833, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MKRKKDNDPPPPKPKRNKGKAVDRGFPSSFAQTQTNLFKNITFENIRTTLKAVKEDTSVPGPSNVVINEKTSMPAVNKDTSVQAVLSAPTPSTNCTPCSYQDVQEISGQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.9
4 0.91
5 0.89
6 0.89
7 0.9
8 0.86
9 0.83
10 0.76
11 0.72
12 0.62
13 0.55
14 0.46
15 0.39
16 0.33
17 0.28
18 0.25
19 0.2
20 0.23
21 0.26
22 0.26
23 0.25
24 0.23
25 0.21
26 0.22
27 0.22
28 0.22
29 0.18
30 0.16
31 0.18
32 0.21
33 0.2
34 0.19
35 0.2
36 0.19
37 0.19
38 0.21
39 0.19
40 0.17
41 0.18
42 0.19
43 0.19
44 0.18
45 0.17
46 0.14
47 0.13
48 0.12
49 0.11
50 0.12
51 0.1
52 0.1
53 0.1
54 0.11
55 0.12
56 0.12
57 0.12
58 0.11
59 0.13
60 0.11
61 0.15
62 0.18
63 0.18
64 0.18
65 0.19
66 0.19
67 0.19
68 0.18
69 0.14
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.1
77 0.11
78 0.13
79 0.17
80 0.19
81 0.2
82 0.23
83 0.25
84 0.26
85 0.33
86 0.34
87 0.32
88 0.37
89 0.37
90 0.36