Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S812

Protein Details
Accession A0A1X0S812    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LKESPLHQLKENRKRYKKHDDIBasic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MYSRVARLASVIPAKKIAFTTAAVSAVYAYAQQCKNDLVEQRAYEEAEIPNDIREILKESPLHQLKENRKRYKKHDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.23
5 0.17
6 0.17
7 0.18
8 0.15
9 0.16
10 0.14
11 0.13
12 0.12
13 0.09
14 0.08
15 0.07
16 0.06
17 0.1
18 0.12
19 0.12
20 0.13
21 0.13
22 0.14
23 0.16
24 0.18
25 0.17
26 0.18
27 0.18
28 0.19
29 0.19
30 0.18
31 0.15
32 0.15
33 0.12
34 0.1
35 0.11
36 0.09
37 0.09
38 0.09
39 0.09
40 0.07
41 0.08
42 0.11
43 0.12
44 0.16
45 0.17
46 0.18
47 0.28
48 0.33
49 0.34
50 0.35
51 0.44
52 0.5
53 0.6
54 0.69
55 0.7
56 0.74
57 0.81
58 0.84