Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RY65

Protein Details
Accession A0A1X0RY65    Localization Confidence High Confidence Score 20.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-38QSSMTNKPLKQKRSQVKNACKYVFHydrophilic
50-74FNKVNCKKACKKCDDRRPCQRCIKYHydrophilic
76-106LVDTCKDSIRKERKREKRGPYKKNAQMKQVMHydrophilic
NLS Segment(s)
PositionSequence
85-98RKERKREKRGPYKK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MQAYQNCHSTTKVKQSSMTNKPLKQKRSQVKNACKYVFLLNELWLILFFFNKVNCKKACKKCDDRRPCQRCIKYNLVDTCKDSIRKERKREKRGPYKKNAQMKQVMLNNQQITLYRHHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.62
4 0.65
5 0.68
6 0.65
7 0.64
8 0.72
9 0.75
10 0.72
11 0.71
12 0.73
13 0.73
14 0.76
15 0.81
16 0.81
17 0.84
18 0.87
19 0.86
20 0.77
21 0.67
22 0.58
23 0.53
24 0.44
25 0.36
26 0.27
27 0.2
28 0.19
29 0.18
30 0.16
31 0.11
32 0.09
33 0.06
34 0.05
35 0.05
36 0.06
37 0.07
38 0.13
39 0.15
40 0.19
41 0.21
42 0.28
43 0.38
44 0.46
45 0.52
46 0.56
47 0.65
48 0.7
49 0.8
50 0.83
51 0.82
52 0.84
53 0.82
54 0.81
55 0.8
56 0.77
57 0.73
58 0.7
59 0.7
60 0.63
61 0.64
62 0.63
63 0.57
64 0.52
65 0.48
66 0.43
67 0.38
68 0.37
69 0.32
70 0.35
71 0.42
72 0.5
73 0.58
74 0.66
75 0.73
76 0.81
77 0.88
78 0.89
79 0.89
80 0.91
81 0.91
82 0.9
83 0.9
84 0.89
85 0.9
86 0.84
87 0.81
88 0.77
89 0.7
90 0.69
91 0.64
92 0.62
93 0.57
94 0.59
95 0.52
96 0.44
97 0.42
98 0.37
99 0.33