Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S2Y4

Protein Details
Accession A0A1X0S2Y4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-75DVVTSFKKEKDRKKEKEKEKKRFNPFALLGBasic
NLS Segment(s)
PositionSequence
52-67KKEKDRKKEKEKEKKR
Subcellular Location(s) mito 16.5, mito_nucl 12, nucl 6.5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MSVQQGTRVTYDRSTLLALAGSPFAKLPPVKMAFIPGVTRTPNQSDVVTSFKKEKDRKKEKEKEKKRFNPFALLGEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.15
4 0.13
5 0.11
6 0.1
7 0.1
8 0.08
9 0.07
10 0.07
11 0.07
12 0.1
13 0.1
14 0.11
15 0.17
16 0.19
17 0.2
18 0.2
19 0.22
20 0.2
21 0.2
22 0.2
23 0.13
24 0.13
25 0.13
26 0.14
27 0.13
28 0.15
29 0.17
30 0.17
31 0.16
32 0.15
33 0.16
34 0.21
35 0.2
36 0.19
37 0.21
38 0.23
39 0.32
40 0.39
41 0.47
42 0.52
43 0.63
44 0.72
45 0.79
46 0.86
47 0.88
48 0.92
49 0.93
50 0.93
51 0.94
52 0.94
53 0.93
54 0.92
55 0.85
56 0.83
57 0.75
58 0.69