Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1N5W7

Protein Details
Accession A0A0A1N5W7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
64-85HQSKPPPPPKEEKKKAHKCVLABasic
NLS Segment(s)
PositionSequence
71-78PPKEEKKK
Subcellular Location(s) mito 17.5, mito_nucl 12.333, nucl 6, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MTSLWNDPFGMNFKKTKKVTTVVVEKPPSKAPCAPPPPSVCYCVNYYPQPYYPPMFPQQPCICHQSKPPPPPKEEKKKAHKCVLACTPDNKCAACKKAEEPKKVYYVVPSFSNPRTVYRVSVMEGKSYTTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.48
4 0.48
5 0.48
6 0.51
7 0.52
8 0.57
9 0.54
10 0.6
11 0.6
12 0.55
13 0.53
14 0.54
15 0.47
16 0.42
17 0.42
18 0.4
19 0.45
20 0.51
21 0.52
22 0.51
23 0.53
24 0.55
25 0.51
26 0.49
27 0.41
28 0.35
29 0.35
30 0.32
31 0.32
32 0.28
33 0.29
34 0.27
35 0.27
36 0.27
37 0.26
38 0.25
39 0.22
40 0.23
41 0.24
42 0.29
43 0.27
44 0.33
45 0.34
46 0.35
47 0.36
48 0.38
49 0.35
50 0.3
51 0.34
52 0.36
53 0.4
54 0.46
55 0.53
56 0.52
57 0.55
58 0.63
59 0.69
60 0.7
61 0.72
62 0.73
63 0.75
64 0.81
65 0.85
66 0.84
67 0.78
68 0.68
69 0.65
70 0.64
71 0.59
72 0.5
73 0.48
74 0.43
75 0.42
76 0.43
77 0.36
78 0.3
79 0.3
80 0.32
81 0.3
82 0.29
83 0.32
84 0.41
85 0.49
86 0.53
87 0.53
88 0.55
89 0.57
90 0.55
91 0.49
92 0.46
93 0.42
94 0.37
95 0.35
96 0.32
97 0.33
98 0.32
99 0.39
100 0.33
101 0.33
102 0.35
103 0.34
104 0.34
105 0.34
106 0.34
107 0.3
108 0.36
109 0.33
110 0.32
111 0.3