Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S8Y4

Protein Details
Accession A0A1X0S8Y4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23VLFAKLSKFRRRTKGTFIKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MSRVLFAKLSKFRRRTKGTFIKVTIQHRKLFLVLQEVLAKVSASTFEDTQLPSVTVSSRVDKQFLAISFASNIASIVEPVSISFAAVEFKGLKVDMSFRNSKLRINVSVLEISGPKFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.79
4 0.8
5 0.79
6 0.79
7 0.73
8 0.71
9 0.69
10 0.72
11 0.71
12 0.65
13 0.59
14 0.52
15 0.5
16 0.43
17 0.38
18 0.3
19 0.26
20 0.22
21 0.2
22 0.2
23 0.19
24 0.18
25 0.16
26 0.14
27 0.08
28 0.07
29 0.06
30 0.07
31 0.08
32 0.08
33 0.09
34 0.1
35 0.1
36 0.11
37 0.11
38 0.1
39 0.08
40 0.08
41 0.08
42 0.09
43 0.1
44 0.11
45 0.15
46 0.15
47 0.16
48 0.15
49 0.16
50 0.17
51 0.16
52 0.18
53 0.14
54 0.13
55 0.13
56 0.13
57 0.12
58 0.09
59 0.09
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.08
75 0.07
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.14
82 0.17
83 0.23
84 0.26
85 0.28
86 0.37
87 0.38
88 0.41
89 0.43
90 0.43
91 0.41
92 0.42
93 0.42
94 0.37
95 0.37
96 0.34
97 0.29
98 0.24