Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S2A5

Protein Details
Accession A0A1X0S2A5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-90ESLHTFRRVPNPRPHRRERYPTVVCHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences LIQDLRAKFGEDAVFVMGNWSAPHARYHEPIRNLDFQSLLKKHGFQAFLIDKYKTSRCCPTCHYESLHTFRRVPNPRPHRRERYPTVVCHAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.1
5 0.09
6 0.08
7 0.09
8 0.09
9 0.09
10 0.12
11 0.15
12 0.18
13 0.22
14 0.28
15 0.33
16 0.36
17 0.39
18 0.41
19 0.43
20 0.41
21 0.37
22 0.32
23 0.26
24 0.3
25 0.27
26 0.25
27 0.21
28 0.2
29 0.22
30 0.25
31 0.24
32 0.17
33 0.23
34 0.22
35 0.24
36 0.25
37 0.23
38 0.19
39 0.22
40 0.27
41 0.23
42 0.25
43 0.31
44 0.32
45 0.36
46 0.4
47 0.44
48 0.45
49 0.46
50 0.46
51 0.43
52 0.47
53 0.5
54 0.53
55 0.48
56 0.46
57 0.46
58 0.53
59 0.55
60 0.56
61 0.6
62 0.63
63 0.71
64 0.77
65 0.83
66 0.83
67 0.85
68 0.87
69 0.85
70 0.85
71 0.8
72 0.76