Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0SG52

Protein Details
Accession A0A1X0SG52    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-31FVPLPGVQQKKRPRRKYHEVERLYKCNHydrophilic
NLS Segment(s)
PositionSequence
15-19KRPRR
55-78GPKRLPAEFKELRKMWRKQKRENK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KVFSFVPLPGVQQKKRPRRKYHEVERLYKCNYQNCTKAYGTLNHLNAHVSMQKHGPKRLPAEFKELRKMWRKQKRENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.7
3 0.76
4 0.79
5 0.81
6 0.89
7 0.9
8 0.91
9 0.91
10 0.87
11 0.86
12 0.82
13 0.78
14 0.71
15 0.65
16 0.57
17 0.52
18 0.49
19 0.45
20 0.44
21 0.39
22 0.41
23 0.36
24 0.36
25 0.32
26 0.3
27 0.3
28 0.3
29 0.3
30 0.26
31 0.26
32 0.23
33 0.21
34 0.2
35 0.18
36 0.13
37 0.13
38 0.17
39 0.23
40 0.27
41 0.32
42 0.35
43 0.37
44 0.43
45 0.5
46 0.53
47 0.5
48 0.55
49 0.58
50 0.58
51 0.62
52 0.58
53 0.58
54 0.59
55 0.65
56 0.67
57 0.71
58 0.75