Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S6U7

Protein Details
Accession A0A1X0S6U7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
117-139DTGALKEGKGKQKQTRKRKYDEABasic
NLS Segment(s)
PositionSequence
124-135GKGKQKQTRKRK
Subcellular Location(s) cyto_nucl 14.5, nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MYFQAIVNSFCGLGPFCFNFSDHESHTVLDLKKKLEIATSVNADEQRIKTMGGRLLNDHDILFQDGLKEPAIFNLTVRMVGGLQRRVIESHLQETRISLEQPIKRQKTNTDCRLSYDTGALKEGKGKQKQTRKRKYDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.16
5 0.17
6 0.2
7 0.23
8 0.26
9 0.23
10 0.26
11 0.25
12 0.25
13 0.26
14 0.28
15 0.25
16 0.27
17 0.28
18 0.25
19 0.26
20 0.28
21 0.26
22 0.22
23 0.23
24 0.21
25 0.23
26 0.23
27 0.22
28 0.22
29 0.22
30 0.21
31 0.21
32 0.18
33 0.16
34 0.14
35 0.14
36 0.14
37 0.17
38 0.2
39 0.2
40 0.2
41 0.19
42 0.22
43 0.22
44 0.21
45 0.17
46 0.14
47 0.12
48 0.12
49 0.1
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.07
56 0.06
57 0.07
58 0.09
59 0.08
60 0.07
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.07
67 0.1
68 0.14
69 0.13
70 0.14
71 0.14
72 0.15
73 0.15
74 0.17
75 0.18
76 0.16
77 0.2
78 0.22
79 0.22
80 0.22
81 0.22
82 0.23
83 0.2
84 0.19
85 0.15
86 0.21
87 0.23
88 0.32
89 0.42
90 0.43
91 0.44
92 0.47
93 0.54
94 0.57
95 0.64
96 0.65
97 0.63
98 0.59
99 0.62
100 0.64
101 0.57
102 0.48
103 0.43
104 0.37
105 0.29
106 0.31
107 0.26
108 0.21
109 0.26
110 0.32
111 0.37
112 0.41
113 0.49
114 0.56
115 0.67
116 0.77
117 0.82
118 0.85
119 0.85