Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RS15

Protein Details
Accession A0A1X0RS15   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-48YFNMKRKKDDDPPHPKAKRNKRKGIRRSRVPFFVCBasic
90-114GAKNQSPNKKTKRKCKQSNGGTEFVHydrophilic
NLS Segment(s)
PositionSequence
18-42KRKKDDDPPHPKAKRNKRKGIRRSR
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010095  Transposase_IS605_OrfB_C  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0032196  P:transposition  
Pfam View protein in Pfam  
PF07282  OrfB_Zn_ribbon  
Amino Acid Sequences MTGLSVATFPFFLYFNMKRKKDDDPPHPKAKRNKRKGIRRSRVPFFVCTNASKFIQLMLKTYINKQKGTQEIVKRLFDNSKKYDTSSTVGAKNQSPNKKTKRKCKQSNGGTEFVSVDEYLTSQICNKCKSKKLNNISITGSKRRVHSVLKCESCGTAWNRDVNSTLNIYNIFVYKSKHDNESPPPFQKTFKRLTVLPGFNALSITAVHSLTPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.42
4 0.44
5 0.48
6 0.5
7 0.58
8 0.6
9 0.64
10 0.66
11 0.67
12 0.72
13 0.79
14 0.81
15 0.81
16 0.81
17 0.82
18 0.82
19 0.82
20 0.85
21 0.85
22 0.9
23 0.93
24 0.94
25 0.93
26 0.93
27 0.91
28 0.87
29 0.85
30 0.78
31 0.71
32 0.63
33 0.58
34 0.5
35 0.45
36 0.4
37 0.35
38 0.32
39 0.28
40 0.24
41 0.21
42 0.23
43 0.21
44 0.2
45 0.21
46 0.24
47 0.25
48 0.31
49 0.36
50 0.34
51 0.35
52 0.35
53 0.37
54 0.38
55 0.43
56 0.44
57 0.43
58 0.48
59 0.51
60 0.51
61 0.45
62 0.43
63 0.44
64 0.41
65 0.41
66 0.37
67 0.38
68 0.36
69 0.37
70 0.38
71 0.33
72 0.31
73 0.28
74 0.27
75 0.24
76 0.25
77 0.25
78 0.25
79 0.28
80 0.33
81 0.36
82 0.36
83 0.43
84 0.51
85 0.59
86 0.65
87 0.69
88 0.73
89 0.78
90 0.85
91 0.86
92 0.87
93 0.85
94 0.89
95 0.82
96 0.74
97 0.63
98 0.53
99 0.42
100 0.32
101 0.24
102 0.13
103 0.08
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.08
110 0.12
111 0.15
112 0.2
113 0.24
114 0.3
115 0.37
116 0.47
117 0.53
118 0.6
119 0.66
120 0.71
121 0.7
122 0.67
123 0.63
124 0.61
125 0.56
126 0.51
127 0.48
128 0.4
129 0.39
130 0.39
131 0.39
132 0.39
133 0.42
134 0.45
135 0.49
136 0.49
137 0.48
138 0.45
139 0.42
140 0.35
141 0.34
142 0.29
143 0.27
144 0.27
145 0.3
146 0.29
147 0.3
148 0.31
149 0.27
150 0.26
151 0.21
152 0.19
153 0.16
154 0.16
155 0.16
156 0.15
157 0.14
158 0.13
159 0.13
160 0.15
161 0.18
162 0.23
163 0.26
164 0.3
165 0.33
166 0.38
167 0.45
168 0.53
169 0.56
170 0.56
171 0.59
172 0.55
173 0.58
174 0.6
175 0.57
176 0.55
177 0.54
178 0.53
179 0.48
180 0.55
181 0.59
182 0.54
183 0.48
184 0.46
185 0.4
186 0.36
187 0.35
188 0.26
189 0.17
190 0.14
191 0.15
192 0.11
193 0.11