Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RXD4

Protein Details
Accession A0A1X0RXD4    Localization Confidence High Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPPKKHRKPLTPLQRKQIKRKRELIHKATVKBasic
116-147QKEQRHAYYKERSEKRRKMLSKTKRGQPKMAAHydrophilic
NLS Segment(s)
PositionSequence
3-23PKKHRKPLTPLQRKQIKRKRE
96-144LKRKRESEQERREKEEKLKEQKEQRHAYYKERSEKRRKMLSKTKRGQPK
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MPPKKHRKPLTPLQRKQIKRKRELIHKATVKSQYYKELNQQKDDTPDYVKEVFGMQERTIDENGNVVELHKPEDEKEQGKRQNKPNPFKSQMEESLKRKRESEQERREKEEKLKEQKEQRHAYYKERSEKRRKMLSKTKRGQPKMAARMDVLLEKIEKQAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.86
4 0.85
5 0.84
6 0.82
7 0.84
8 0.83
9 0.84
10 0.87
11 0.82
12 0.84
13 0.8
14 0.73
15 0.7
16 0.68
17 0.61
18 0.55
19 0.5
20 0.49
21 0.46
22 0.47
23 0.49
24 0.51
25 0.51
26 0.52
27 0.52
28 0.46
29 0.47
30 0.46
31 0.39
32 0.32
33 0.3
34 0.28
35 0.26
36 0.23
37 0.18
38 0.16
39 0.15
40 0.15
41 0.17
42 0.12
43 0.15
44 0.16
45 0.18
46 0.18
47 0.17
48 0.14
49 0.13
50 0.13
51 0.1
52 0.09
53 0.07
54 0.09
55 0.08
56 0.11
57 0.1
58 0.1
59 0.11
60 0.15
61 0.18
62 0.19
63 0.24
64 0.3
65 0.37
66 0.42
67 0.49
68 0.53
69 0.58
70 0.64
71 0.69
72 0.68
73 0.7
74 0.69
75 0.65
76 0.59
77 0.55
78 0.54
79 0.53
80 0.51
81 0.48
82 0.52
83 0.55
84 0.53
85 0.49
86 0.46
87 0.48
88 0.52
89 0.57
90 0.59
91 0.64
92 0.67
93 0.73
94 0.72
95 0.67
96 0.65
97 0.64
98 0.63
99 0.63
100 0.64
101 0.64
102 0.71
103 0.74
104 0.76
105 0.73
106 0.68
107 0.68
108 0.65
109 0.66
110 0.66
111 0.66
112 0.67
113 0.69
114 0.73
115 0.74
116 0.8
117 0.81
118 0.82
119 0.8
120 0.8
121 0.82
122 0.83
123 0.84
124 0.84
125 0.84
126 0.84
127 0.83
128 0.8
129 0.79
130 0.79
131 0.77
132 0.74
133 0.67
134 0.57
135 0.54
136 0.48
137 0.41
138 0.31
139 0.23
140 0.19
141 0.18