Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RS66

Protein Details
Accession A0A1X0RS66    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-183EPSPEEKEQRKKAKLEKEKKRRKALKKARYLKKKAAQEQKDTQBasic
NLS Segment(s)
PositionSequence
51-58RQKKKARK
147-175KEQRKKAKLEKEKKRRKALKKARYLKKKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Pfam View protein in Pfam  
PF12874  zf-met  
Amino Acid Sequences MFKRVQKELAKQHIEENEFDPNDEEEKLAGVFSDTDTDSDSDNSDDEETRRQKKKARKALIAAINAGAGSSSEEEEEESEKEKDEQTIETYTCNICPDKQLKNEKQVEIHLQSRQHRRRERYLIKTGQLQSDGQVPEANKEPSPEEKEQRKKAKLEKEKKRRKALKKARYLKKKAAQEQKDTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.5
3 0.43
4 0.4
5 0.35
6 0.35
7 0.3
8 0.25
9 0.24
10 0.22
11 0.2
12 0.11
13 0.12
14 0.11
15 0.09
16 0.08
17 0.06
18 0.06
19 0.07
20 0.09
21 0.08
22 0.09
23 0.1
24 0.11
25 0.12
26 0.12
27 0.12
28 0.1
29 0.1
30 0.11
31 0.1
32 0.11
33 0.11
34 0.19
35 0.25
36 0.33
37 0.4
38 0.43
39 0.49
40 0.58
41 0.68
42 0.7
43 0.73
44 0.72
45 0.71
46 0.75
47 0.74
48 0.65
49 0.55
50 0.44
51 0.35
52 0.27
53 0.21
54 0.12
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.09
66 0.09
67 0.09
68 0.1
69 0.11
70 0.11
71 0.11
72 0.11
73 0.11
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.12
81 0.1
82 0.08
83 0.13
84 0.17
85 0.21
86 0.29
87 0.39
88 0.41
89 0.5
90 0.55
91 0.52
92 0.49
93 0.46
94 0.44
95 0.38
96 0.37
97 0.31
98 0.3
99 0.36
100 0.45
101 0.5
102 0.54
103 0.58
104 0.62
105 0.68
106 0.74
107 0.77
108 0.75
109 0.77
110 0.73
111 0.67
112 0.68
113 0.61
114 0.53
115 0.45
116 0.36
117 0.28
118 0.29
119 0.26
120 0.19
121 0.19
122 0.17
123 0.18
124 0.22
125 0.23
126 0.17
127 0.18
128 0.21
129 0.25
130 0.32
131 0.36
132 0.4
133 0.49
134 0.58
135 0.67
136 0.74
137 0.74
138 0.74
139 0.77
140 0.8
141 0.81
142 0.82
143 0.83
144 0.84
145 0.89
146 0.91
147 0.93
148 0.93
149 0.92
150 0.93
151 0.93
152 0.92
153 0.92
154 0.93
155 0.93
156 0.93
157 0.91
158 0.9
159 0.88
160 0.88
161 0.87
162 0.87
163 0.85