Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RSH7

Protein Details
Accession A0A1X0RSH7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42GSYHRQTPKKRSPLLKREDCDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 5, cyto 4, extr 4, E.R. 4, golg 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MFKYCLFYALVFSILILTSEAGSYHRQTPKKRSPLLKREDCDISCNGELANCADRCYNSRIGREKGRDAIKVVCQSNMCYCGFEAGDDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.07
4 0.06
5 0.05
6 0.06
7 0.06
8 0.07
9 0.09
10 0.11
11 0.19
12 0.25
13 0.31
14 0.37
15 0.47
16 0.56
17 0.63
18 0.68
19 0.7
20 0.74
21 0.78
22 0.82
23 0.8
24 0.71
25 0.66
26 0.64
27 0.54
28 0.47
29 0.38
30 0.31
31 0.23
32 0.22
33 0.17
34 0.12
35 0.12
36 0.11
37 0.15
38 0.11
39 0.12
40 0.12
41 0.13
42 0.16
43 0.2
44 0.27
45 0.26
46 0.33
47 0.38
48 0.43
49 0.51
50 0.53
51 0.53
52 0.52
53 0.53
54 0.48
55 0.44
56 0.44
57 0.42
58 0.44
59 0.4
60 0.36
61 0.33
62 0.34
63 0.36
64 0.35
65 0.29
66 0.23
67 0.22
68 0.22
69 0.21