Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RPZ0

Protein Details
Accession A0A1X0RPZ0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
79-121RITKPNKKPVRQQQPQKKQQQKPKNDKKGSKQKKKPLSQEDLDHydrophilic
NLS Segment(s)
PositionSequence
63-114RLGKPVDTRRKPAMAGRITKPNKKPVRQQQPQKKQQQKPKNDKKGSKQKKKP
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MSSNTRRIVTNARTVSYSSGGLNERFANLEKSKKPTHNPVIQSKSVFSRIKADSPKLKSIQQRLGKPVDTRRKPAMAGRITKPNKKPVRQQQPQKKQQQKPKNDKKGSKQKKKPLSQEDLDKSLDAYMMKDPKTAQAKLDEELTTYMQEAELEEETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.33
4 0.28
5 0.19
6 0.2
7 0.21
8 0.2
9 0.21
10 0.19
11 0.17
12 0.18
13 0.19
14 0.21
15 0.22
16 0.29
17 0.31
18 0.37
19 0.44
20 0.49
21 0.53
22 0.58
23 0.63
24 0.64
25 0.66
26 0.69
27 0.69
28 0.65
29 0.6
30 0.51
31 0.46
32 0.45
33 0.4
34 0.31
35 0.31
36 0.31
37 0.36
38 0.39
39 0.41
40 0.41
41 0.45
42 0.5
43 0.45
44 0.49
45 0.48
46 0.51
47 0.54
48 0.53
49 0.52
50 0.51
51 0.52
52 0.49
53 0.46
54 0.49
55 0.5
56 0.46
57 0.47
58 0.46
59 0.44
60 0.43
61 0.43
62 0.42
63 0.37
64 0.38
65 0.36
66 0.43
67 0.44
68 0.5
69 0.5
70 0.51
71 0.53
72 0.53
73 0.61
74 0.61
75 0.69
76 0.72
77 0.79
78 0.8
79 0.83
80 0.88
81 0.89
82 0.88
83 0.85
84 0.87
85 0.87
86 0.86
87 0.87
88 0.88
89 0.89
90 0.88
91 0.87
92 0.88
93 0.89
94 0.89
95 0.89
96 0.88
97 0.87
98 0.88
99 0.89
100 0.89
101 0.87
102 0.84
103 0.78
104 0.78
105 0.73
106 0.66
107 0.58
108 0.48
109 0.38
110 0.3
111 0.26
112 0.16
113 0.13
114 0.15
115 0.19
116 0.2
117 0.21
118 0.21
119 0.28
120 0.34
121 0.34
122 0.31
123 0.34
124 0.36
125 0.35
126 0.39
127 0.31
128 0.26
129 0.27
130 0.25
131 0.18
132 0.16
133 0.15
134 0.11
135 0.11
136 0.1
137 0.11