Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0L9V7

Protein Details
Accession J0L9V7   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-41QAAPRRARLTRKAQKTRFATHydrophilic
NLS Segment(s)
PositionSequence
25-33PRRARLTRK
110-138RRSPRRRPATPPPAQAPPRRARLTRKAQK
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_177742  -  
Amino Acid Sequences MVNVPRRSLRRKVATPPPAELQAAPRRARLTRKAQKTRFATNSEAHHVHDAVTSVRGSYSVGDELLSFDLGRSLQPGSSNIPIPPIDPPTILFIKATAARVHDSMVNVPRRSPRRRPATPPPAQAPPRRARLTRKAQKVRFAVDPEARDAHDAADSEAPSTTSDDHEDWSDLSTSAGYSVVQAPTVGILVDAALDLTDGRDRSVLTSVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.74
3 0.7
4 0.65
5 0.58
6 0.52
7 0.43
8 0.41
9 0.4
10 0.44
11 0.4
12 0.39
13 0.4
14 0.44
15 0.51
16 0.51
17 0.54
18 0.57
19 0.66
20 0.74
21 0.76
22 0.81
23 0.79
24 0.8
25 0.75
26 0.69
27 0.63
28 0.57
29 0.56
30 0.53
31 0.48
32 0.4
33 0.36
34 0.31
35 0.27
36 0.23
37 0.19
38 0.13
39 0.13
40 0.12
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.07
55 0.06
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.12
65 0.14
66 0.15
67 0.14
68 0.16
69 0.15
70 0.15
71 0.16
72 0.15
73 0.14
74 0.13
75 0.14
76 0.15
77 0.16
78 0.16
79 0.13
80 0.11
81 0.12
82 0.13
83 0.14
84 0.1
85 0.11
86 0.12
87 0.12
88 0.13
89 0.12
90 0.11
91 0.12
92 0.17
93 0.21
94 0.2
95 0.21
96 0.27
97 0.33
98 0.4
99 0.46
100 0.49
101 0.54
102 0.6
103 0.67
104 0.71
105 0.74
106 0.74
107 0.71
108 0.65
109 0.63
110 0.63
111 0.59
112 0.56
113 0.52
114 0.53
115 0.52
116 0.52
117 0.52
118 0.57
119 0.64
120 0.65
121 0.7
122 0.72
123 0.72
124 0.77
125 0.72
126 0.66
127 0.6
128 0.54
129 0.5
130 0.44
131 0.41
132 0.36
133 0.33
134 0.3
135 0.26
136 0.22
137 0.17
138 0.14
139 0.13
140 0.11
141 0.13
142 0.13
143 0.12
144 0.12
145 0.12
146 0.11
147 0.12
148 0.11
149 0.1
150 0.13
151 0.13
152 0.14
153 0.15
154 0.15
155 0.15
156 0.15
157 0.15
158 0.11
159 0.11
160 0.1
161 0.08
162 0.08
163 0.08
164 0.06
165 0.07
166 0.1
167 0.1
168 0.1
169 0.1
170 0.1
171 0.1
172 0.1
173 0.08
174 0.05
175 0.04
176 0.04
177 0.04
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.05
184 0.09
185 0.09
186 0.1
187 0.11
188 0.12
189 0.14
190 0.18