Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S8S5

Protein Details
Accession A0A1X0S8S5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-79MELIKNSKDKRAKKLCKARLGTFHydrophilic
NLS Segment(s)
PositionSequence
64-74KDKRAKKLCKA
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAASGIAVGINKGHITTRRTLKAKPSNKIGAASKRSVFVKSVIREVSGFAPYERRLMELIKNSKDKRAKKLCKARLGTFVRAKKKIDELTAVIASSRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.26
4 0.34
5 0.42
6 0.46
7 0.48
8 0.56
9 0.61
10 0.66
11 0.64
12 0.64
13 0.61
14 0.6
15 0.61
16 0.57
17 0.55
18 0.52
19 0.49
20 0.42
21 0.39
22 0.38
23 0.35
24 0.29
25 0.24
26 0.27
27 0.25
28 0.28
29 0.25
30 0.24
31 0.23
32 0.23
33 0.21
34 0.15
35 0.13
36 0.1
37 0.12
38 0.12
39 0.14
40 0.12
41 0.12
42 0.11
43 0.13
44 0.17
45 0.22
46 0.27
47 0.31
48 0.38
49 0.38
50 0.45
51 0.52
52 0.54
53 0.56
54 0.62
55 0.66
56 0.7
57 0.8
58 0.81
59 0.82
60 0.83
61 0.77
62 0.75
63 0.72
64 0.69
65 0.67
66 0.67
67 0.66
68 0.64
69 0.62
70 0.56
71 0.59
72 0.56
73 0.51
74 0.47
75 0.42
76 0.43
77 0.41
78 0.37
79 0.29