Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S5S5

Protein Details
Accession A0A1X0S5S5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-39IPSMQLEHKQKTKKKKRKLYRNNARFRDPPHydrophilic
NLS Segment(s)
PositionSequence
16-37EHKQKTKKKKRKLYRNNARFRD
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRKKLTKRAIPSMQLEHKQKTKKKKRKLYRNNARFRDPPHRRVIFAYDDASLPSPMRRFTPTPSKKLCRHLTTKEIVTLVDEYRTSRVCSHCKNDLQNIVVPERGFDCDHRYANIINIHSCTRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.63
4 0.62
5 0.66
6 0.67
7 0.7
8 0.73
9 0.76
10 0.81
11 0.86
12 0.89
13 0.91
14 0.95
15 0.95
16 0.95
17 0.95
18 0.95
19 0.89
20 0.85
21 0.77
22 0.72
23 0.72
24 0.68
25 0.65
26 0.64
27 0.6
28 0.55
29 0.53
30 0.51
31 0.43
32 0.37
33 0.32
34 0.23
35 0.21
36 0.2
37 0.19
38 0.15
39 0.11
40 0.1
41 0.1
42 0.1
43 0.12
44 0.15
45 0.16
46 0.2
47 0.31
48 0.34
49 0.41
50 0.47
51 0.52
52 0.53
53 0.61
54 0.64
55 0.58
56 0.6
57 0.57
58 0.56
59 0.54
60 0.5
61 0.43
62 0.36
63 0.3
64 0.24
65 0.21
66 0.15
67 0.12
68 0.11
69 0.1
70 0.12
71 0.14
72 0.14
73 0.16
74 0.22
75 0.27
76 0.34
77 0.39
78 0.44
79 0.49
80 0.53
81 0.56
82 0.55
83 0.51
84 0.48
85 0.45
86 0.38
87 0.35
88 0.29
89 0.23
90 0.2
91 0.2
92 0.18
93 0.17
94 0.22
95 0.26
96 0.27
97 0.28
98 0.29
99 0.27
100 0.31
101 0.35
102 0.31
103 0.27
104 0.29