Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RNI7

Protein Details
Accession A0A1X0RNI7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29RKRVRTTRACVYCRKKKIRCDGHHPTCSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences RKRVRTTRACVYCRKKKIRCDGHHPTCSNCLQLQLNCEYAESKKRGPRKGYVQTLEERLTEMEKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.79
4 0.85
5 0.86
6 0.83
7 0.83
8 0.83
9 0.82
10 0.83
11 0.74
12 0.66
13 0.6
14 0.53
15 0.45
16 0.34
17 0.27
18 0.22
19 0.22
20 0.22
21 0.18
22 0.19
23 0.17
24 0.17
25 0.15
26 0.14
27 0.2
28 0.2
29 0.24
30 0.29
31 0.37
32 0.44
33 0.48
34 0.55
35 0.58
36 0.65
37 0.69
38 0.68
39 0.65
40 0.62
41 0.62
42 0.55
43 0.45
44 0.37
45 0.28
46 0.27