Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RJX0

Protein Details
Accession A0A1X0RJX0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-106PLYEWTLPRRKRKMKIHTFVSRTHydrophilic
NLS Segment(s)
PositionSequence
93-96RKRK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
CDD cd09275  RNase_HI_RT_DIRS1  
Amino Acid Sequences LLTIFFALQLHTKRFESSTIRIFSDNITAIKYVSKSSGIASGYLKEVAIRIHEIRNKHQLDLQVFRIPGISNIQADKLSRKMLPLYEWTLPRRKRKMKIHTFVSRTNHRLPTYRSLRPDPLAKVTGAFQQKWLKKGLHLSPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.33
4 0.35
5 0.39
6 0.38
7 0.39
8 0.38
9 0.37
10 0.32
11 0.31
12 0.27
13 0.2
14 0.18
15 0.16
16 0.16
17 0.18
18 0.17
19 0.14
20 0.13
21 0.13
22 0.13
23 0.13
24 0.17
25 0.15
26 0.16
27 0.16
28 0.16
29 0.15
30 0.15
31 0.14
32 0.1
33 0.1
34 0.09
35 0.09
36 0.11
37 0.12
38 0.17
39 0.2
40 0.23
41 0.27
42 0.36
43 0.36
44 0.33
45 0.34
46 0.33
47 0.34
48 0.35
49 0.33
50 0.27
51 0.26
52 0.25
53 0.23
54 0.19
55 0.15
56 0.14
57 0.12
58 0.09
59 0.1
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.13
66 0.12
67 0.13
68 0.14
69 0.15
70 0.16
71 0.18
72 0.2
73 0.22
74 0.25
75 0.28
76 0.35
77 0.4
78 0.48
79 0.54
80 0.59
81 0.65
82 0.72
83 0.8
84 0.82
85 0.84
86 0.84
87 0.83
88 0.79
89 0.77
90 0.73
91 0.7
92 0.64
93 0.62
94 0.59
95 0.52
96 0.53
97 0.51
98 0.54
99 0.54
100 0.55
101 0.55
102 0.54
103 0.57
104 0.56
105 0.57
106 0.5
107 0.49
108 0.45
109 0.39
110 0.34
111 0.31
112 0.34
113 0.33
114 0.29
115 0.3
116 0.37
117 0.41
118 0.43
119 0.46
120 0.41
121 0.41
122 0.49