Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0SBY5

Protein Details
Accession A0A1X0SBY5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-94APKPLRYKPNKLEKHERTRAEBasic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR040922  MRPL25_dom  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSTFRTFSGKFLSKLENAKFVEADVKPQLVYNEAKGKSFWRPPRLSRRIQADLRKACIQEGIEPTSIGLLPKTAPKPLRYKPNKLEKHERTRAERQATIQRNMEKMPQTIQAWKEEKLKELAKQKSSMPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.44
4 0.4
5 0.4
6 0.36
7 0.32
8 0.34
9 0.26
10 0.28
11 0.23
12 0.22
13 0.2
14 0.21
15 0.21
16 0.18
17 0.19
18 0.19
19 0.25
20 0.25
21 0.25
22 0.25
23 0.27
24 0.31
25 0.38
26 0.42
27 0.43
28 0.48
29 0.55
30 0.66
31 0.71
32 0.7
33 0.67
34 0.67
35 0.65
36 0.66
37 0.66
38 0.64
39 0.6
40 0.58
41 0.55
42 0.47
43 0.39
44 0.34
45 0.27
46 0.22
47 0.22
48 0.2
49 0.17
50 0.17
51 0.16
52 0.14
53 0.14
54 0.09
55 0.06
56 0.04
57 0.05
58 0.09
59 0.11
60 0.15
61 0.17
62 0.21
63 0.29
64 0.34
65 0.45
66 0.47
67 0.56
68 0.6
69 0.69
70 0.73
71 0.73
72 0.79
73 0.77
74 0.81
75 0.8
76 0.77
77 0.74
78 0.74
79 0.75
80 0.7
81 0.63
82 0.57
83 0.59
84 0.59
85 0.56
86 0.53
87 0.49
88 0.45
89 0.44
90 0.45
91 0.38
92 0.34
93 0.32
94 0.32
95 0.3
96 0.34
97 0.35
98 0.38
99 0.37
100 0.4
101 0.45
102 0.4
103 0.42
104 0.43
105 0.45
106 0.43
107 0.5
108 0.55
109 0.52
110 0.53