Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RZL2

Protein Details
Accession A0A1X0RZL2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-42LLSDRCRGKKRSTKNDPKINTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 8.833, nucl 8.5, cyto_mito 8.166, mito 8, cyto 7, cyto_pero 4.833
Family & Domain DBs
Amino Acid Sequences MAKECGWNIYRCVKQWAARGLLSDRCRGKKRSTKNDPKINTQLGDDFDIGDLDDIYGENGSEHSSDDNPVRFFPSASSQGSMFIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.5
4 0.46
5 0.43
6 0.43
7 0.4
8 0.42
9 0.39
10 0.39
11 0.38
12 0.41
13 0.45
14 0.47
15 0.53
16 0.54
17 0.63
18 0.67
19 0.73
20 0.77
21 0.82
22 0.88
23 0.81
24 0.8
25 0.75
26 0.66
27 0.55
28 0.45
29 0.37
30 0.28
31 0.27
32 0.19
33 0.13
34 0.1
35 0.1
36 0.09
37 0.07
38 0.05
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.11
53 0.14
54 0.18
55 0.18
56 0.19
57 0.22
58 0.21
59 0.2
60 0.21
61 0.25
62 0.26
63 0.27
64 0.28
65 0.25