Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S4W2

Protein Details
Accession A0A1X0S4W2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-79GLFWILSKKKRSRVRGKTLKIEEKIHHydrophilic
NLS Segment(s)
PositionSequence
61-73KKKRSRVRGKTLK
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MKRDRKIRRNPDGTPIALGRESVLAYVKAITDIYSKQKALGLNPMAQQEDPSLGLFWILSKKKRSRVRGKTLKIEEKIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.48
3 0.4
4 0.31
5 0.28
6 0.19
7 0.14
8 0.13
9 0.1
10 0.1
11 0.08
12 0.08
13 0.08
14 0.08
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.14
21 0.17
22 0.17
23 0.17
24 0.19
25 0.2
26 0.19
27 0.24
28 0.2
29 0.2
30 0.22
31 0.23
32 0.21
33 0.2
34 0.19
35 0.13
36 0.12
37 0.1
38 0.09
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.14
45 0.17
46 0.22
47 0.3
48 0.38
49 0.47
50 0.57
51 0.66
52 0.7
53 0.77
54 0.83
55 0.86
56 0.87
57 0.88
58 0.89
59 0.88