Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S542

Protein Details
Accession A0A1X0S542   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27NNNNNKPSHLKKLYKSNNNNNNNNDKKHydrophilic
55-77TPLQRRYTSSKTKRNERRKEIYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences NNNNNKPSHLKKLYKSNNNNNNNNDKKPQKREEQIHSVILKTPIARRPSVSAPTTPLQRRYTSSKTKRNERRKEIYEVLNAELEPVSDLDNSSSSSSDTNTSTIRKRHHSNNAIDGRVYAGPMFSNSPAPDTLPIPTFSSSPIVPIVQEPVNILSASASPSFSLREFDVDLSEIQSKLRALLKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.85
5 0.87
6 0.88
7 0.83
8 0.83
9 0.79
10 0.74
11 0.72
12 0.71
13 0.71
14 0.73
15 0.74
16 0.73
17 0.76
18 0.79
19 0.79
20 0.79
21 0.73
22 0.69
23 0.62
24 0.53
25 0.47
26 0.4
27 0.33
28 0.25
29 0.27
30 0.27
31 0.29
32 0.29
33 0.28
34 0.31
35 0.35
36 0.39
37 0.36
38 0.31
39 0.32
40 0.35
41 0.4
42 0.39
43 0.4
44 0.37
45 0.37
46 0.39
47 0.42
48 0.47
49 0.51
50 0.57
51 0.6
52 0.64
53 0.73
54 0.79
55 0.83
56 0.85
57 0.83
58 0.83
59 0.78
60 0.78
61 0.72
62 0.66
63 0.59
64 0.5
65 0.42
66 0.34
67 0.28
68 0.21
69 0.16
70 0.11
71 0.08
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.11
88 0.14
89 0.17
90 0.22
91 0.26
92 0.3
93 0.34
94 0.41
95 0.5
96 0.55
97 0.55
98 0.6
99 0.6
100 0.55
101 0.5
102 0.41
103 0.33
104 0.26
105 0.22
106 0.12
107 0.07
108 0.07
109 0.08
110 0.09
111 0.08
112 0.11
113 0.11
114 0.12
115 0.13
116 0.13
117 0.14
118 0.13
119 0.14
120 0.13
121 0.15
122 0.15
123 0.16
124 0.15
125 0.15
126 0.17
127 0.15
128 0.14
129 0.14
130 0.12
131 0.12
132 0.12
133 0.15
134 0.13
135 0.14
136 0.13
137 0.13
138 0.14
139 0.14
140 0.13
141 0.1
142 0.09
143 0.12
144 0.11
145 0.1
146 0.09
147 0.1
148 0.13
149 0.13
150 0.15
151 0.13
152 0.16
153 0.17
154 0.17
155 0.18
156 0.17
157 0.17
158 0.17
159 0.19
160 0.16
161 0.15
162 0.17
163 0.15
164 0.18