Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1PCQ5

Protein Details
Accession A0A0A1PCQ5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
168-194INNKQLKYIENYKKRKKREGQINCCISHydrophilic
NLS Segment(s)
PositionSequence
180-185KKRKKR
Subcellular Location(s) nucl 19, mito 2, pero 2, cyto 1, plas 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR003595  Tyr_Pase_cat  
IPR000387  Tyr_Pase_dom  
Gene Ontology GO:0016791  F:phosphatase activity  
GO:0016311  P:dephosphorylation  
PROSITE View protein in PROSITE  
PS50056  TYR_PHOSPHATASE_2  
CDD cd14500  PTP-IVa  
Amino Acid Sequences MLKPPAYDKIQKPLLHPPTYVTYNDKRFLIIDTPSISNISRYLKEFERWNVTDVVRCCKAAYSQSLLTEKGIQVHDWFFSDGEFPPQMVIDHWLRLIDSRFNKMTAQDVEEEKTDDNNDDEPKKPCIAAHCVTGLGRAPILIAIALIEEGMDPLESVEFIRKRRQGAINNKQLKYIENYKKRKKREGQINCCIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.56
3 0.52
4 0.47
5 0.45
6 0.46
7 0.44
8 0.4
9 0.4
10 0.42
11 0.45
12 0.42
13 0.36
14 0.34
15 0.34
16 0.31
17 0.25
18 0.22
19 0.22
20 0.23
21 0.22
22 0.23
23 0.2
24 0.18
25 0.19
26 0.2
27 0.19
28 0.21
29 0.24
30 0.26
31 0.29
32 0.33
33 0.35
34 0.39
35 0.38
36 0.38
37 0.38
38 0.35
39 0.37
40 0.34
41 0.35
42 0.28
43 0.27
44 0.25
45 0.22
46 0.24
47 0.22
48 0.24
49 0.23
50 0.23
51 0.27
52 0.28
53 0.28
54 0.26
55 0.24
56 0.2
57 0.19
58 0.18
59 0.14
60 0.14
61 0.14
62 0.14
63 0.13
64 0.13
65 0.09
66 0.09
67 0.1
68 0.08
69 0.11
70 0.1
71 0.09
72 0.08
73 0.09
74 0.09
75 0.08
76 0.11
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.1
83 0.11
84 0.13
85 0.14
86 0.17
87 0.18
88 0.19
89 0.19
90 0.19
91 0.22
92 0.17
93 0.17
94 0.16
95 0.16
96 0.17
97 0.17
98 0.17
99 0.13
100 0.13
101 0.11
102 0.1
103 0.1
104 0.11
105 0.14
106 0.15
107 0.18
108 0.2
109 0.23
110 0.23
111 0.22
112 0.2
113 0.22
114 0.26
115 0.25
116 0.24
117 0.22
118 0.22
119 0.22
120 0.22
121 0.18
122 0.12
123 0.1
124 0.08
125 0.07
126 0.06
127 0.06
128 0.05
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.04
143 0.05
144 0.12
145 0.16
146 0.18
147 0.27
148 0.31
149 0.34
150 0.42
151 0.5
152 0.52
153 0.6
154 0.68
155 0.7
156 0.76
157 0.74
158 0.69
159 0.62
160 0.55
161 0.51
162 0.51
163 0.51
164 0.52
165 0.62
166 0.7
167 0.79
168 0.85
169 0.88
170 0.87
171 0.87
172 0.88
173 0.89
174 0.89