Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1NG16

Protein Details
Accession A0A0A1NG16    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-168KHPAHPKKPAHSKKPSHPKKPAHPKKPTHPKKPTHPKEKLAARREAAHKKKPAHPKKPAHPKKPAHPKKPTHPKKPAQHBasic
NLS Segment(s)
PositionSequence
85-168KRAVKKHPAHPKKPAHSKKPSHPKKPAHPKKPTHPKKPTHPKEKLAARREAAHKKKPAHPKKPAHPKKPAHPKKPTHPKKPAQH
Subcellular Location(s) extr 20, golg 2, mito 1, cyto 1, pero 1, E.R. 1, vacu 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018392  LysM_dom  
IPR036779  LysM_dom_sf  
Pfam View protein in Pfam  
PF01476  LysM  
PROSITE View protein in PROSITE  
PS51782  LYSM  
CDD cd00118  LysM  
Amino Acid Sequences MKLFVVACAALSAFGLVQAFDHYPFPCHESYTAESGDTCQSIASKHNVSLDDLSSWTQEFNEDFECGQIKKGDLVCINYSLSIAKRAVKKHPAHPKKPAHSKKPSHPKKPAHPKKPTHPKKPTHPKEKLAARREAAHKKKPAHPKKPAHPKKPAHPKKPTHPKKPAQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.07
6 0.08
7 0.09
8 0.12
9 0.12
10 0.14
11 0.15
12 0.19
13 0.17
14 0.18
15 0.18
16 0.21
17 0.24
18 0.25
19 0.25
20 0.21
21 0.2
22 0.2
23 0.21
24 0.16
25 0.13
26 0.09
27 0.09
28 0.1
29 0.13
30 0.16
31 0.16
32 0.17
33 0.21
34 0.21
35 0.23
36 0.23
37 0.21
38 0.17
39 0.16
40 0.15
41 0.12
42 0.12
43 0.1
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.1
50 0.09
51 0.1
52 0.12
53 0.11
54 0.12
55 0.11
56 0.1
57 0.13
58 0.13
59 0.16
60 0.16
61 0.18
62 0.18
63 0.18
64 0.18
65 0.14
66 0.14
67 0.11
68 0.1
69 0.1
70 0.1
71 0.13
72 0.17
73 0.2
74 0.25
75 0.34
76 0.37
77 0.43
78 0.54
79 0.59
80 0.61
81 0.68
82 0.72
83 0.72
84 0.79
85 0.79
86 0.78
87 0.78
88 0.8
89 0.8
90 0.82
91 0.83
92 0.82
93 0.83
94 0.81
95 0.82
96 0.87
97 0.88
98 0.87
99 0.87
100 0.84
101 0.86
102 0.89
103 0.88
104 0.88
105 0.87
106 0.84
107 0.86
108 0.9
109 0.89
110 0.88
111 0.86
112 0.81
113 0.8
114 0.82
115 0.8
116 0.76
117 0.72
118 0.64
119 0.63
120 0.66
121 0.68
122 0.67
123 0.66
124 0.67
125 0.66
126 0.73
127 0.76
128 0.79
129 0.79
130 0.81
131 0.82
132 0.85
133 0.9
134 0.93
135 0.91
136 0.9
137 0.88
138 0.88
139 0.9
140 0.9
141 0.88
142 0.88
143 0.86
144 0.86
145 0.89
146 0.88
147 0.88
148 0.88